SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G13960 | AT | Annotation by Michelle Graham. TAIR10: SU(VAR)3-9 homolog 4 | chr5:4501688-4505979 FORWARD LENGTH=624 | SoyBase | E_val: 2.00E-108 | ISS |
| GO:0000085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle | SoyBase | N/A | ISS |
| GO:0000226 | GO-bp | Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization | SoyBase | N/A | ISS |
| GO:0000911 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation | SoyBase | N/A | ISS |
| GO:0006260 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA replication | SoyBase | N/A | ISS |
| GO:0006270 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA replication initiation | SoyBase | N/A | ISS |
| GO:0006275 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication | SoyBase | N/A | ISS |
| GO:0006306 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA methylation | SoyBase | N/A | ISS |
| GO:0006342 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing | SoyBase | N/A | ISS |
| GO:0006346 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing | SoyBase | N/A | ISS |
| GO:0007267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell-cell signaling | SoyBase | N/A | ISS |
| GO:0008283 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell proliferation | SoyBase | N/A | ISS |
| GO:0009616 | GO-bp | Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing | SoyBase | N/A | ISS |
| GO:0009640 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photomorphogenesis | SoyBase | N/A | ISS |
| GO:0009855 | GO-bp | Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry | SoyBase | N/A | ISS |
| GO:0010014 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem initiation | SoyBase | N/A | ISS |
| GO:0010073 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem maintenance | SoyBase | N/A | ISS |
| GO:0010216 | GO-bp | Annotation by Michelle Graham. GO Biological Process: maintenance of DNA methylation | SoyBase | N/A | ISS |
| GO:0010267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference | SoyBase | N/A | ISS |
| GO:0016567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein ubiquitination | SoyBase | N/A | ISS |
| GO:0016571 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone methylation | SoyBase | N/A | ISS |
| GO:0016572 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone phosphorylation | SoyBase | N/A | ISS |
| GO:0016579 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein deubiquitination | SoyBase | N/A | ISS |
| GO:0018022 | GO-bp | Annotation by Michelle Graham. GO Biological Process: peptidyl-lysine methylation | SoyBase | N/A | ISS |
| GO:0031047 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA | SoyBase | N/A | ISS |
| GO:0031048 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA | SoyBase | N/A | ISS |
| GO:0034968 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone lysine methylation | SoyBase | N/A | ISS |
| GO:0035196 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA | SoyBase | N/A | ISS |
| GO:0045893 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0051567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation | SoyBase | N/A | ISS |
| GO:0051726 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
| GO:0008327 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: methyl-CpG binding | SoyBase | N/A | ISS |
| GO:0010385 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: double-stranded methylated DNA binding | SoyBase | N/A | ISS |
| GO:0010428 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: methyl-CpNpG binding | SoyBase | N/A | ISS |
| GO:0010429 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: methyl-CpNpN binding | SoyBase | N/A | ISS |
| GO:0018024 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: histone-lysine N-methyltransferase activity | SoyBase | N/A | ISS |
| GO:0042393 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: histone binding | SoyBase | N/A | ISS |
| GO:0046974 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: histone methyltransferase activity (H3-K9 specific) | SoyBase | N/A | ISS |
| KOG1082 | KOG | Histone H3 (Lys9) methyltransferase SUV39H1/Clr4, required for transcriptional silencing | JGI | ISS | |
| PTHR22884 | Panther | SET DOMAIN PROTEINS | JGI | ISS | |
| PTHR22884:SF114 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF00856 | PFAM | SET domain | JGI | ISS | |
| PF05033 | PFAM | Pre-SET motif | JGI | ISS | |
| UniRef100_G7KY38 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 n=1 Tax=Medicago truncatula RepID=G7KY38_MEDTR | SoyBase | E_val: 2.00E-115 | ISS |
| UniRef100_UPI0002337CEF | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002337CEF related cluster n=1 Tax=unknown RepID=UPI0002337CEF | SoyBase | E_val: 0 | ISS |
|
Glyma09g32703 not represented in the dataset |
Glyma09g32703 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma01g34971 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g194500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g32703.1 sequence type=CDS gene model=Glyma09g32703 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCTGAATTGAAGGGAGATGACCATCTTATAAAGAATCTTCGACGAGTAGCAAGAAATGTGAATAAGATTGTTGCTGAAGGACAAATATCCAGAGCACCTTCTAGTTATCCTTCTTTGGTTTGTAGGGACCTCAGCAATGGTCTAGAAGCTATACCCATTCCAGTTACTAATGAGATTGATGATTCTCCTATCACACCTAACGGCTTTACATATATCACATCTAGCCAAGTTGCAAACAACGTGAAAGTTCCATCTAGTGATGACTATGGTTGTCAATGCAAAGGAAATAGTTGTAGAACTAACAAGAATTGTTGTTTTAGACTTAATAACATGTATCCATATGTTCGTCGTCGGAAATGTAGCAGATTGATCCAAGCTAGAGATATTGTGTTTGAATGTGGTCCAAGATGTGGATGTGGTCCTGATTGTGGCAGTAGAGTATCTCAGAAGGGTTTGCAGTACCAGCTTGAGGTTTATCGTACGTCTGACAAAGGATGGGCTGTTAGAACTAGGAATTTTATTCCTGTTGGAGCTTTAGTTTGTGAACTTGTTGGGGTACTAAAGAGAACTGAAGACTTGGATAATGATTCACACAATGACTACATAGTTGAAATTGATGGCTGGGAAACTATAAAAGAGATAGGTGGACGAAAGAAACGATTGCCTGACGAGCCATTGCCTGCAAAAATTTTCCTTGAAAATAAGGATGATGAGACAACCAAAAATGATCCAGAGTTCTGTATAGATTGTAGTTCTTTTGGTAATGTGGCTAGGTTCATCAACCATAGTTGTGATCCTAACCTATTTGTTCAATGTGTTTTGAACTCCCATTATGGGATCAAACAAGCTCGAATTGTACTATTTGCTGGAAGAAACATACGTCCTAAACAGGAACTTACTTATGACTATGGTTACCGACTTGATAGTGTTGCTGATGTCGATGGAAAAATCAAGCAATTACCATGTTACTGTGGTGAAGCTACTTGTCGCAAGCGTTTATACTAG
>Glyma09g32703.1 sequence type=predicted peptide gene model=Glyma09g32703 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSELKGDDHLIKNLRRVARNVNKIVAEGQISRAPSSYPSLVCRDLSNGLEAIPIPVTNEIDDSPITPNGFTYITSSQVANNVKVPSSDDYGCQCKGNSCRTNKNCCFRLNNMYPYVRRRKCSRLIQARDIVFECGPRCGCGPDCGSRVSQKGLQYQLEVYRTSDKGWAVRTRNFIPVGALVCELVGVLKRTEDLDNDSHNDYIVEIDGWETIKEIGGRKKRLPDEPLPAKIFLENKDDETTKNDPEFCIDCSSFGNVARFINHSCDPNLFVQCVLNSHYGIKQARIVLFAGRNIRPKQELTYDYGYRLDSVADVDGKIKQLPCYCGEATCRKRLY*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
