SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g32590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g32590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g32590

Feature Type:gene_model
Chromosome:Gm09
Start:39097990
stop:39099020
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g32590
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G28830AT Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr4:14232490-14233917 FORWARD LENGTH=208 SoyBaseE_val: 1.00E-25ISS
GO:0032259GO-bp Annotation by Michelle Graham. GO Biological Process: methylation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0008168GO-mf Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity SoyBaseN/AISS
PTHR23290Panther SAM (AND SOME OTHER NUCLEOTIDE) BINDING MOTIF-CONTAINING JGI ISS
UniRef100_G7IA40UniRef Annotation by Michelle Graham. Most informative UniRef hit: Methyltransferase-like protein n=1 Tax=Medicago truncatula RepID=G7IA40_MEDTR SoyBaseE_val: 2.00E-27ISS
UniRef100_UPI0002339160UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339160 related cluster n=1 Tax=unknown RepID=UPI0002339160 SoyBaseE_val: 8.00E-28ISS

Expression Patterns of Glyma09g32590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g32590 not represented in the dataset
Glyma09g32590 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g32590
ParalogEvidenceComments
Glyma01g34690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g32590 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma09g32590
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g32590
>Glyma09g32590.1   sequence type=CDS   gene model=Glyma09g32590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTATCTTGGTATTGTCTCTAGGTCCAATTGTTGATACAGTTATAATGAATTCTCCATTTGGTTCTCGGAAAAAAGGTGCACATTTGGATTTTCTCTCTGTTGCTTTGAAGGTTGCTTCTCAAACTGTTTATTCCTTGCATAAGACTTCAACAAGAGATCTAATACTCCTTGAACTATCCTCGTTTTTCTCACACAAATTTTCCCCACAGTTGCAAGCTCAATTCTCCTACAAAATACAAACCACCACCAATCATGTGAAACGAATAGCATTAAGGGATTTCAATGCTAGCAGTGCTGAAGTTATATGTGAG
Predicted protein sequences of Glyma09g32590
>Glyma09g32590.1   sequence type=predicted peptide   gene model=Glyma09g32590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVILVLSLGPIVDTVIMNSPFGSRKKGAHLDFLSVALKVASQTVYSLHKTSTRDLILLELSSFFSHKFSPQLQAQFSYKIQTTTNHVKRIALRDFNASSAEVICE






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo