Glyma09g32291 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g32291): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g32291): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g32291

Feature Type:	gene_model
Chromosome:	Gm09
Start:	38827432
stop:	38829189
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g32291

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G10740	AT	Annotation by Michelle Graham. TAIR10: alpha-L-arabinofuranosidase 1 \| chr3:3361031-3364573 REVERSE LENGTH=678	SoyBase	E_val: 2.00E-14	ISS
GO:0010413	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process	SoyBase	N/A	ISS
GO:0045492	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process	SoyBase	N/A	ISS
GO:0045493	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylan catabolic process	SoyBase	N/A	ISS
GO:0046373	GO-bp	Annotation by Michelle Graham. GO Biological Process: L-arabinose metabolic process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0009505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0009044	GO-mf	Annotation by Michelle Graham. GO Molecular Function: xylan 1,4-beta-xylosidase activity	SoyBase	N/A	ISS
GO:0016798	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds	SoyBase	N/A	ISS
GO:0046556	GO-mf	Annotation by Michelle Graham. GO Molecular Function: alpha-N-arabinofuranosidase activity	SoyBase	N/A	ISS
UniRef100_G7JUS1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: THO complex subunit n=1 Tax=Medicago truncatula RepID=G7JUS1_MEDTR	SoyBase	E_val: 2.00E-15	ISS
UniRef100_I1LQS7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LQS7_SOYBN	SoyBase	E_val: 7.00E-24	ISS

Expression Patterns of Glyma09g32291

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g32291 not represented in the dataset	Glyma09g32291 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g32291 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma09g32291

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g32291

Limit To All Plant Sequences

>Glyma09g32291.1   sequence type=CDS   gene model=Glyma09g32291   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACCTACTCATCGGTTCCCCAACCGTGCCGCCAATCGCGCCGCACCTTATGCCACCGCTAAGGTACCTTTTACTTTCATCTATTGCGTCAAAGGTGACGTGGCAACATGATTTATATGCAGATCAGCATGTGGCTGCGGCGGGGTACCCTGCTCAAGGTGGTCGTGCAGCTTCCATAGAAATTGGGATCAAGCTTTACATTTCAAACTTGGATTATGGTGTTTCCAATGATGATATCAAGCTAGCAGAAGACCTTGGGACATTGCCGATATGGGTGTTTAACGCTGGTTTCAGCCTTAATGATGAAATTGATACATCATCCATAGAATCCTATGTGCAAGGAGCTTTCGATGGCATTGAATTTGCAAGAGGCTCTCCTACATCACAATGGGACCAAAGTTAG

Predicted protein sequences of Glyma09g32291

Limit To All Plant Sequences

>Glyma09g32291.1   sequence type=predicted peptide   gene model=Glyma09g32291   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLLIGSPTVPPIAPHLMPPLRYLLLSSIASKVTWQHDLYADQHVAAAGYPAQGGRAASIEIGIKLYISNLDYGVSNDDIKLAEDLGTLPIWVFNAGFSLNDEIDTSSIESYVQGAFDGIEFARGSPTSQWDQS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain