Glyma09g31880 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g31880): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g31880): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g31880

Feature Type:	gene_model
Chromosome:	Gm09
Start:	38476089
stop:	38478338
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g31880

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G20050	AT	Annotation by Michelle Graham. TAIR10: C-8,7 sterol isomerase \| chr1:6949160-6950135 FORWARD LENGTH=223	SoyBase	E_val: 4.00E-84	ISS
GO:0006084	GO-bp	Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process	SoyBase	N/A	ISS
GO:0016125	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol metabolic process	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0016132	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process	SoyBase	N/A	ISS
GO:0019932	GO-bp	Annotation by Michelle Graham. GO Biological Process: second-messenger-mediated signaling	SoyBase	N/A	ISS
GO:0060964	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of gene silencing by miRNA	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0000247	GO-mf	Annotation by Michelle Graham. GO Molecular Function: C-8 sterol isomerase activity	SoyBase	N/A	ISS
GO:0047750	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cholestenol delta-isomerase activity	SoyBase	N/A	ISS
KOG4826	KOG	C-8,7 sterol isomerase	JGI		ISS
PTHR14207	Panther	STEROL ISOMERASE	JGI		ISS
PF05241	PFAM	Emopamil binding protein	JGI		ISS
UniRef100_B9RG26	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Sterol isomerase, putative n=1 Tax=Ricinus communis RepID=B9RG26_RICCO	SoyBase	E_val: 2.00E-92	ISS
UniRef100_I1L4E4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1L4E4_SOYBN	SoyBase	E_val: 2.00E-144	ISS

Expression Patterns of Glyma09g31880

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g31880 not represented in the dataset	Glyma09g31880 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g31880 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g186800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g31880

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g31880

Limit To All Plant Sequences

>Glyma09g31880.1   sequence type=CDS   gene model=Glyma09g31880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGGTCTCGAGTCTCAGAGTCAGAGGGTCACCCCTACGTCCCACGTGACTTGCACCTTCCTGGCTACGTTCCTTGCTTCCTTTCCGTCTCTAACATTCTATCTGTCTATGTCTTCTCTTCTCTCCTCCTTCTCTCTCTCGTCTGGATCTTCTCAGGACGCCTTATGAAAACCACAGTCGATAGACTGCTGATGTGCTGGTTGGCCTTCACAGGCCTCACACACACGATTATTGAGGGTTATTTTGTTTTCTCACCTGAGTTTTTCAAGGATAGGAATGGCTTCTACCTGGCTGAAGTTTGGAAGGAATATAGCAAAGCGGATTCAAGGTATGCAGGAAGGAATGCTGCAGTAGTTGGTTTTGAGGGCCCAACAGCTGTTTTTGTGGGTCCAGCTTGCCTTCTAGCAGTATATGCAATTGCAACTGAGAAGTCATATAGCTACATACTTCAGTTTTCCGTTTCTTTGGGCCAACTATACGGAATTGCTGTTTATTATATAACAGGAATCTTGGAAGGTGATGATTTTTCTGCAAGTTTGTTTTACTATTATGCATACTATATTCTAGCAAATTCCCCCTGGATTGTAATACCCTCAATCGTTGCCATCCGCTGCTGGAGGAAGATCTGTGCAGCATTCTGA

Predicted protein sequences of Glyma09g31880

Limit To All Plant Sequences

>Glyma09g31880.1   sequence type=predicted peptide   gene model=Glyma09g31880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGSRVSESEGHPYVPRDLHLPGYVPCFLSVSNILSVYVFSSLLLLSLVWIFSGRLMKTTVDRLLMCWLAFTGLTHTIIEGYFVFSPEFFKDRNGFYLAEVWKEYSKADSRYAGRNAAVVGFEGPTAVFVGPACLLAVYAIATEKSYSYILQFSVSLGQLYGIAVYYITGILEGDDFSASLFYYYAYYILANSPWIVIPSIVAIRCWRKICAAF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain