SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g31731): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g31731): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g31731

Feature Type:gene_model
Chromosome:Gm09
Start:38381644
stop:38382460
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g31731
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G25855AT Annotation by Michelle Graham. TAIR10: Copper transport protein family | chr3:9459608-9460267 REVERSE LENGTH=112 SoyBaseE_val: 5.00E-25ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
KOG1603 KOG Copper chaperone JGI ISS
PTHR22814Panther COPPER TRANSPORT PROTEIN ATOX1-RELATED JGI ISS
PTHR22814:SF58Panther OS09G0408500 PROTEIN JGI ISS
UniRef100_Q69N34UniRef Annotation by Michelle Graham. Most informative UniRef hit: Agenet domain-containing protein / bromo-adjacent homology (BAH) domain-containing protein-like n=1 Tax=Oryza sativa Japonica Group RepID=Q69N34_ORYSJ SoyBaseE_val: 6.00E-20ISS
UniRef100_UPI0002338FE4UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338FE4 related cluster n=1 Tax=unknown RepID=UPI0002338FE4 SoyBaseE_val: 6.00E-73ISS

Expression Patterns of Glyma09g31731
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g31731 not represented in the dataset
Glyma09g31731 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g31731
ParalogEvidenceComments
Glyma07g10040 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g31731 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g185400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g31731
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g31731
>Glyma09g31731.1   sequence type=CDS   gene model=Glyma09g31731   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAGTGAAGTACTTCTGCATGGTGATGAGGATCAATATTGATTGTAATGGTTGCTACAGAAAAGTGAAGAGAGCCCTTCTTGATATGCCAGAGTTGGATACTCATCTGCTAGAGAAGAACCAGACCAGGGTGGTTGTGTGTGGAAGGTTCATCCCACAGGATGTTGCAATCAGGATAAAGAAAAAAACTAACCGTAGAGTTGAGATATTGGACATACAAGACTTGAGTGAGAGCAATGCTGAAATGGAAGACCAGAAACCAATGACCAATAATTGGACTCTTCTAGCCACCCAGAATAAAATGGAAACATGTCTGGCTTGA
Predicted protein sequences of Glyma09g31731
>Glyma09g31731.1   sequence type=predicted peptide   gene model=Glyma09g31731   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTVKYFCMVMRINIDCNGCYRKVKRALLDMPELDTHLLEKNQTRVVVCGRFIPQDVAIRIKKKTNRRVEILDIQDLSESNAEMEDQKPMTNNWTLLATQNKMETCLA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo