SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g31087): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g31087): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g31087

Feature Type:gene_model
Chromosome:Gm09
Start:37848070
stop:37850595
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G33090AT Annotation by Michelle Graham. TAIR10: aminopeptidase M1 | chr4:15965915-15970418 REVERSE LENGTH=879 SoyBaseE_val: 2.00E-76ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0010359GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of anion channel activity SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004177GO-mf Annotation by Michelle Graham. GO Molecular Function: aminopeptidase activity SoyBaseN/AISS
GO:0008237GO-mf Annotation by Michelle Graham. GO Molecular Function: metallopeptidase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR11533Panther PROTEASE M1 ZINC METALLOPROTEASE JGI ISS
PTHR11533:SF97Panther JGI ISS
PF01433PFAM Peptidase family M1 JGI ISS
UniRef100_G7J8C0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Puromycin-sensitive aminopeptidase n=1 Tax=Medicago truncatula RepID=G7J8C0_MEDTR SoyBaseE_val: 1.00E-85ISS
UniRef100_I1JTY8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTY8_SOYBN SoyBaseE_val: 7.00E-102ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g31087 not represented in the dataset

Glyma09g31087 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g179600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g31087.1   sequence type=CDS   gene model=Glyma09g31087   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCAATTCAAAGGACAACCTTGTTTTCTAAAATTCTCCGTTCCAAAATGCTACAACATTAGGCTCAAGATCAACCTCATCGCGCACCGTTTTGCAAGTTTCGCCATCGTCAACCCCGACATTGTCATTGCCACCTCTTTCATCGTTCTCAATACTACCAAACTCTCTGTTAGCAACGACGCCATTTCATTCACCAACCAAGGTTCCTCCAAGGTTATTAAACCTTCTCGAGTTAAGTTGTTTGAAAATGATGAGATTATGGTTTTAGAGTTCACAGAGGAATTACCTATTGGCTTCAGTGTCTTGTCCATTCGCTCTAAAGTAATCTTGAATGATAGAGTGAAAGGCTTCTATCGAAGTACCTATGAGCACAATGGTGAGAAAAAGAGTATGGCAGTTAGACAGTTTGAACCAATTGATGCCAAGCAATGCATCCCTTGTTGGGATGAAGCTGCTTGCAAGGCTACTTTCAAGATCACGTTGGATGTGACTTCAGAGCTCGTTGCTCTTTCCAACATGCCAATTGTTGAAGAAATAACAGATGGAAATCTCAAAACAGTCTCATATCAAGAATCACCAATTATGTGGTCAAAGTTCGAGTGTATTATCAAGTTGACTGAGGATCCATGGGTTGCACTTGAGGAAGGATCTGGTGAACCTGTGAACAAGTCAATGGCCTTATGGACAAAGCAGAAGGGATATCCTGCTGTATCTGTTAAAGTCAATGATTGA

>Glyma09g31087.1   sequence type=predicted peptide   gene model=Glyma09g31087   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDQFKGQPCFLKFSVPKCYNIRLKINLIAHRFASFAIVNPDIVIATSFIVLNTTKLSVSNDAISFTNQGSSKVIKPSRVKLFENDEIMVLEFTEELPIGFSVLSIRSKVILNDRVKGFYRSTYEHNGEKKSMAVRQFEPIDAKQCIPCWDEAACKATFKITLDVTSELVALSNMPIVEEITDGNLKTVSYQESPIMWSKFECIIKLTEDPWVALEEGSGEPVNKSMALWTKQKGYPAVSVKVND*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo