|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
ATCG00360 | AT | Annotation by Michelle Graham. TAIR10: Tetratricopeptide repeat (TPR)-like superfamily protein | chrC:42584-43751 REVERSE LENGTH=126 | SoyBase | E_val: 1.00E-47 | ISS |
GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
GO:0048564 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem I assembly | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0051082 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding | SoyBase | N/A | ISS |
PTHR26312 | Panther | FAMILY NOT NAMED | JGI | ISS | |
PTHR26312:SF22 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
PF00515 | PFAM | Tetratricopeptide repeat | JGI | ISS | |
UniRef100_D7KRG3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Photosystem I assembly protein Ycf3 n=4 Tax=core eudicotyledons RepID=D7KRG3_ARALL | SoyBase | E_val: 3.00E-49 | ISS |
UniRef100_D7KRG3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Photosystem I assembly protein Ycf3 n=4 Tax=core eudicotyledons RepID=D7KRG3_ARALL | SoyBase | E_val: 3.00E-49 | ISS |
Glyma09g30970 not represented in the dataset |
Glyma09g30970 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.09g178600 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g30970.2 sequence type=CDS gene model=Glyma09g30970 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCAGTTCAATCTGAAGGAAATTATGCGGAAGCTTTACAGAACTATTATGAGACTATGCGACAGAAAATTGATCCCTATGATCGAAGTTATATACTTTATAACATAGGCCTTATCCACACAAGTAACGGAGAACATACTAAAGCTTTGAAATATTATTTTCGGGCTCTCGAGCGAAACCCATTCTTACCCCAAGCTTTTAATAATATGATTGTGCTCTGTCATTACGTGCGACTATCTCCACTATAG
>Glyma09g30970.2 sequence type=predicted peptide gene model=Glyma09g30970 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSVQSEGNYAEALQNYYETMRQKIDPYDRSYILYNIGLIHTSNGEHTKALKYYFRALERNPFLPQAFNNMIVLCHYVRLSPL*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||