|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G10450 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein L6 family | chr4:6463201-6464458 REVERSE LENGTH=194 | SoyBase | E_val: 3.00E-11 | ISS |
| GO:0001510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA methylation | SoyBase | N/A | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
| GO:0015934 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit | SoyBase | N/A | ISS |
| GO:0022625 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit | SoyBase | N/A | ISS |
| GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| GO:0019843 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: rRNA binding | SoyBase | N/A | ISS |
| UniRef100_B3TLR1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal L9-like protein n=1 Tax=Elaeis guineensis RepID=B3TLR1_ELAGV | SoyBase | E_val: 1.00E-08 | ISS |
| UniRef100_I1MAF0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MAF0_SOYBN | SoyBase | E_val: 2.00E-16 | ISS |
|
Glyma09g30111 not represented in the dataset |
Glyma09g30111 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g30111.1 sequence type=CDS gene model=Glyma09g30111 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCAGTAAAAGGAAGCTTAAGATTCGTGTACGCTCATTTTCCGATCAAAGCTAGCATTGGCAACAACAACAAGTCCATCAAGATCAAAAATTTCCTCGGCGAGAAGAAGAGACATGTAGGTGCTCGATCATATTTTGAAAAAAGGGAAGCTTCACTTGTATGGAGTTACAGACATGCAGGTATTGATTTGTTTTTAGGAAGACTATTATTTGTTTTGCCTGCTTGA
>Glyma09g30111.1 sequence type=predicted peptide gene model=Glyma09g30111 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAVKGSLRFVYAHFPIKASIGNNNKSIKIKNFLGEKKRHVGARSYFEKREASLVWSYRHAGIDLFLGRLLFVLPA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||