SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g29521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g29521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g29521

Feature Type:gene_model
Chromosome:Gm09
Start:36381941
stop:36383468
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G55805AT Annotation by Michelle Graham. TAIR10: BolA-like family protein | chr1:20858956-20859438 REVERSE LENGTH=160 SoyBaseE_val: 1.00E-37ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0019243GO-bp Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
KOG2313 KOG Stress-induced protein UVI31+ JGI ISS
PTHR12735Panther BOLA-LIKE PROTEIN-RELATED JGI ISS
PTHR12735:SF3Panther BOLA-LIKE PROTEIN CGI-143 JGI ISS
PF01722PFAM BolA-like protein JGI ISS
UniRef100_A6N0A8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Uv-induced protein uvi31 n=4 Tax=Oryza RepID=A6N0A8_ORYSI SoyBaseE_val: 1.00E-44ISS
UniRef100_I1L3W3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L3W3_SOYBN SoyBaseE_val: 3.00E-66ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g29521 not represented in the dataset

Glyma09g29521 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma16g34010 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g29521.1   sequence type=CDS   gene model=Glyma09g29521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGACGGGACGGGTATTGTCTTCACAATCCCTTACCCAGACCCTCCCAACATATCCCTGATATCGGGTTTAAGTTTATTATCTCATCTTCGTATCCGTCGGTCATAATAATCGGATATTATCCGTCAGTAGCCAGAGGTGGAAATATAAACTTTCCCTCCCCAATTTCTGTCCATGTTTTCATCTGCGGAAACTCCTCCGTTCTCAAAACCCTAACCCGACGCCACCATTCATCCGATCCAATGAGTTCGAGAGGAGCCAGCGCGCTGCTATCTCGAGCCAGCAGGATTCGCTCGAAGCTTCAAACGGCGCTGGAAGCCACCGTTTTGGAGGTGGACGACGTGTCGTACCAGCACGCGGGCCACGCCGCCGTGAAGGGAAGTTCCGACAAAGAAACCCACTTCAACGTGAAGATCGTATCGCCCAAGTTCGAGGGCCAGAGCCTCGTCAAACGACACCGTCTCGTCTACGACCTCCTCGCCGAGGAGCTCCAGAGCGGCCTCCACGCCCTCTCTATCGTCGCCAAAACGCTCCACGAAACAAACCCTAATAAGTGA

>Glyma09g29521.1   sequence type=predicted peptide   gene model=Glyma09g29521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRDGYCLHNPLPRPSQHIPDIGFKFIISSSYPSVIIIGYYPSVARGGNINFPSPISVHVFICGNSSVLKTLTRRHHSSDPMSSRGASALLSRASRIRSKLQTALEATVLEVDDVSYQHAGHAAVKGSSDKETHFNVKIVSPKFEGQSLVKRHRLVYDLLAEELQSGLHALSIVAKTLHETNPNK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo