SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 156 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g29350): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g29350): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g29350

Feature Type:gene_model
Chromosome:Gm09
Start:36253235
stop:36254105
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G17860AT Annotation by Michelle Graham. TAIR10: Kunitz family trypsin and protease inhibitor protein | chr1:6149343-6149933 FORWARD LENGTH=196 SoyBaseE_val: 5.00E-43ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004866GO-mf Annotation by Michelle Graham. GO Molecular Function: endopeptidase inhibitor activity SoyBaseN/AISS
PF00197PFAM Trypsin and protease inhibitor JGI ISS
UniRef100_C6TLR5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TLR5_SOYBN SoyBaseE_val: 4.00E-151ISS
UniRef100_G7KKP6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pathogen-inducible trypsin-inhibitor-like protein n=1 Tax=Medicago truncatula RepID=G7KKP6_MEDTR SoyBaseE_val: 1.00E-87ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g29350 not represented in the dataset

Glyma09g29350 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma16g33790 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g163800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g29350.1   sequence type=CDS   gene model=Glyma09g29350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAGCACAATGCTGCTAGCATTTGCCCTTGTCTTAGCCTTGAGTTCACAACCACTGCTAGGAGGAGCTGAAGCCTCACCCGAGCAAGTGGTTGACACATTAGGCAAGAAGCTCCGAGTTGGAACCAATTACTATATTGTCCCATCTCTTCCCTACACCAAAATTAGAACCACTAGAGGCCTTGGCCTAGCCAGTGTTGGAAAACCTTATTGTCCTCTTGATGTTGTGGTTGTGAATGGATACCATGGCTTGCCAGTGACATTCTCACCAGTTAATCCTAAGAAAGGGGTCATTCGTGTCTCAACTGATTTGAACATCAAGTTCTCTGCTCGCACTAGTTGTCCCCGCCAATATTCCACGGTTTGGAAACTTGATGATTTTGATTTCTCAAAGAGACAATGGTTTGTGACCACTGGTGGTGTTGTGGGAAACCCTAGCTTGGAAACCATCCACAACTGGTTCAAGATTGAGAAGTACGATGGTGCTTACAAATTGGTCTATTGTCCCAGCGTGGTGAAATGTCCAAAGCATTTGTGCAAGAATGTTGGGTTGTTTGTGGATGAGAAAGGGAACAAGCGTCTTGCTCTCACTGATGTTCCCCTCAAAGTTCAATTCCAACAAGCCTAA

>Glyma09g29350.1   sequence type=predicted peptide   gene model=Glyma09g29350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKSTMLLAFALVLALSSQPLLGGAEASPEQVVDTLGKKLRVGTNYYIVPSLPYTKIRTTRGLGLASVGKPYCPLDVVVVNGYHGLPVTFSPVNPKKGVIRVSTDLNIKFSARTSCPRQYSTVWKLDDFDFSKRQWFVTTGGVVGNPSLETIHNWFKIEKYDGAYKLVYCPSVVKCPKHLCKNVGLFVDEKGNKRLALTDVPLKVQFQQA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo