|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G17860 | AT | Annotation by Michelle Graham. TAIR10: Kunitz family trypsin and protease inhibitor protein | chr1:6149343-6149933 FORWARD LENGTH=196 | SoyBase | E_val: 5.00E-32 | ISS |
| GO:0006457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein folding | SoyBase | N/A | ISS |
| GO:0009408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to heat | SoyBase | N/A | ISS |
| GO:0009644 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to high light intensity | SoyBase | N/A | ISS |
| GO:0010167 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to nitrate | SoyBase | N/A | ISS |
| GO:0015706 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nitrate transport | SoyBase | N/A | ISS |
| GO:0034976 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress | SoyBase | N/A | ISS |
| GO:0042542 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| GO:0004866 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: endopeptidase inhibitor activity | SoyBase | N/A | ISS |
| PF00197 | PFAM | Trypsin and protease inhibitor | JGI | ISS | |
| UniRef100_G7KKR0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Miraculin n=1 Tax=Medicago truncatula RepID=G7KKR0_MEDTR | SoyBase | E_val: 4.00E-51 | ISS |
| UniRef100_I1L3T3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L3T3_SOYBN | SoyBase | E_val: 1.00E-101 | ISS |
|
Glyma09g29200 not represented in the dataset |
Glyma09g29200 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g162600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g29200.2 sequence type=CDS gene model=Glyma09g29200 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCAAGCACAGGTGCAGATTGCCCACTTGATGTTGTAGCTGTTGATGGTTACCAAGGCCAGCCTTTGATCTTTACACCTGTTAATTTTAACAAAGGTGTCATTCGTGTTTCCACTGATCTCAACATTTATTTCCCCGTTGGCACAAGTTGTCCACAGACCACAGTGTGGAAGCTTAAGGACTATGATTATTCAGCATCACAGTGGTTTGTGACTACTGGTGGTGATTTCGGCAATCCCGGTTCGCAAACCATGGCGAATTGGTTCAAGATTGAGAAGTATGAGGATGCTTACAAGTTGGTCTACGGTCCAAGTGTGTGCAACGATTGCAGTTATCCATGCAGTGATATTGGAATATACCAGGATGAATATGGCAAGCGTCTTGCTCTAAGTTCTGAACCATACAAAGTGAAGTTCCAGCGGGCTTAA
>Glyma09g29200.2 sequence type=predicted peptide gene model=Glyma09g29200 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MASTGADCPLDVVAVDGYQGQPLIFTPVNFNKGVIRVSTDLNIYFPVGTSCPQTTVWKLKDYDYSASQWFVTTGGDFGNPGSQTMANWFKIEKYEDAYKLVYGPSVCNDCSYPCSDIGIYQDEYGKRLALSSEPYKVKFQRA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||