SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g28828): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g28828): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g28828

Feature Type:gene_model
Chromosome:Gm09
Start:35811630
stop:35811974
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g28828
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G01435AT Annotation by Michelle Graham. TAIR10: Expressed protein | chr3:166853-167984 REVERSE LENGTH=115 SoyBaseE_val: 3.00E-24ISS
GO:0006357GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription from RNA polymerase II promoter SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016592GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mediator complex SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF10280PFAM Mediator complex protein JGI ISS
UniRef100_G7LCE4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Retinoblastoma-binding protein n=1 Tax=Medicago truncatula RepID=G7LCE4_MEDTR SoyBaseE_val: 3.00E-33ISS
UniRef100_UPI0002338A29UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338A29 related cluster n=1 Tax=unknown RepID=UPI0002338A29 SoyBaseE_val: 9.00E-37ISS

Expression Patterns of Glyma09g28828
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g28828 not represented in the dataset
Glyma09g28828 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g28828 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma09g28828
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g28828
>Glyma09g28828.1   sequence type=CDS   gene model=Glyma09g28828   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AATGATTTATTGTATAGACTTGAATTAGAGAAGGAACACAAGAAATCAACATCCATGGATTCACAGGGCCAAACAACTTCATTGCAGAGACTTCAAAATGTAGAAAAGAGAATTGTGAAGGTTTTGGAGCTTGTAGGAGGAGTCATGGATGAGCTTGCAAGCCCTGTTGGTCCTAGGAAGGATGTGGTCCAAAACCACTGCCTTGAGTTCATGCAATTAATCAAGGTCATTGTCTCCCAGAAATGA
Predicted protein sequences of Glyma09g28828
>Glyma09g28828.1   sequence type=predicted peptide   gene model=Glyma09g28828   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
NDLLYRLELEKEHKKSTSMDSQGQTTSLQRLQNVEKRIVKVLELVGGVMDELASPVGPRKDVVQNHCLEFMQLIKVIVSQK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo