Glyma09g28516 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g28516): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g28516): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g28516

Feature Type:	gene_model
Chromosome:	Gm09
Start:	35460305
stop:	35460589
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g28516

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G64420	AT	Annotation by Michelle Graham. TAIR10: DNA polymerase V family \| chr5:25756416-25761122 FORWARD LENGTH=1306	SoyBase	E_val: 2.00E-22	ISS
GO:0006260	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA replication	SoyBase	N/A	ISS
GO:0006351	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009165	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-directed DNA polymerase activity	SoyBase	N/A	ISS
PTHR13213	Panther	DNA POLYMERASE V RELATED	JGI		ISS
PTHR13213:SF1	Panther	gb def: similar to myb binding protein (p160) 1a, nuclear protein p160 [mus musculus]	JGI		ISS
UniRef100_A2Q1A6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA polymerase V n=1 Tax=Medicago truncatula RepID=A2Q1A6_MEDTR	SoyBase	E_val: 5.00E-29	ISS
UniRef100_UPI000233B3A5	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233B3A5 related cluster n=1 Tax=unknown RepID=UPI000233B3A5	SoyBase	E_val: 7.00E-44	ISS

Expression Patterns of Glyma09g28516

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g28516 not represented in the dataset	Glyma09g28516 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g28516 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g157200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g28516

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g28516

Limit To All Plant Sequences

>Glyma09g28516.1   sequence type=CDS   gene model=Glyma09g28516   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACTAGTGGCGGCAGTGCTATGTTGGAGTTCCACATTGGCGTGTTCAAGGACCTCGCGGCGGCGTCCAAGTCGGTGAGGGAAGTCGCCGCAAAGCAAATGGTGATGGAGTTGAAGGTTGTTCATAACGCTTATGATTCACACGAGAAGGAGAGTGGTGAGGGTGGATTGAAATTGGAAGCGGAGAAAGATGATGGATTGGATAACTGTGCTCCGTCTGTGAGATACGTTGTTCGTAGGCTTATTCGCGGTGTTTCTTCGTCCAGAGAGGTTTGTTACATTTTGTGA

Predicted protein sequences of Glyma09g28516

Limit To All Plant Sequences

>Glyma09g28516.1   sequence type=predicted peptide   gene model=Glyma09g28516   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TSGGSAMLEFHIGVFKDLAAASKSVREVAAKQMVMELKVVHNAYDSHEKESGEGGLKLEAEKDDGLDNCAPSVRYVVRRLIRGVSSSREVCYIL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain