|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G64420 | AT | Annotation by Michelle Graham. TAIR10: DNA polymerase V family | chr5:25756416-25761122 FORWARD LENGTH=1306 | SoyBase | E_val: 2.00E-22 | ISS |
| GO:0006260 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA replication | SoyBase | N/A | ISS |
| GO:0006351 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0009165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003887 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA-directed DNA polymerase activity | SoyBase | N/A | ISS |
| PTHR13213 | Panther | DNA POLYMERASE V RELATED | JGI | ISS | |
| PTHR13213:SF1 | Panther | gb def: similar to myb binding protein (p160) 1a, nuclear protein p160 [mus musculus] | JGI | ISS | |
| UniRef100_A2Q1A6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: DNA polymerase V n=1 Tax=Medicago truncatula RepID=A2Q1A6_MEDTR | SoyBase | E_val: 5.00E-29 | ISS |
| UniRef100_UPI000233B3A5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233B3A5 related cluster n=1 Tax=unknown RepID=UPI000233B3A5 | SoyBase | E_val: 7.00E-44 | ISS |
|
Glyma09g28516 not represented in the dataset |
Glyma09g28516 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g157200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g28516.1 sequence type=CDS gene model=Glyma09g28516 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ACTAGTGGCGGCAGTGCTATGTTGGAGTTCCACATTGGCGTGTTCAAGGACCTCGCGGCGGCGTCCAAGTCGGTGAGGGAAGTCGCCGCAAAGCAAATGGTGATGGAGTTGAAGGTTGTTCATAACGCTTATGATTCACACGAGAAGGAGAGTGGTGAGGGTGGATTGAAATTGGAAGCGGAGAAAGATGATGGATTGGATAACTGTGCTCCGTCTGTGAGATACGTTGTTCGTAGGCTTATTCGCGGTGTTTCTTCGTCCAGAGAGGTTTGTTACATTTTGTGA
>Glyma09g28516.1 sequence type=predicted peptide gene model=Glyma09g28516 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TSGGSAMLEFHIGVFKDLAAASKSVREVAAKQMVMELKVVHNAYDSHEKESGEGGLKLEAEKDDGLDNCAPSVRYVVRRLIRGVSSSREVCYIL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||