SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g28503): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g28503): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g28503

Feature Type:gene_model
Chromosome:Gm09
Start:35455707
stop:35457414
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G15093AT Annotation by Michelle Graham. TAIR10: catalytic LigB subunit of aromatic ring-opening dioxygenase family | chr4:8618454-8619472 FORWARD LENGTH=269 SoyBaseE_val: 2.00E-77ISS
GO:0006725GO-bp Annotation by Michelle Graham. GO Biological Process: cellular aromatic compound metabolic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0008198GO-mf Annotation by Michelle Graham. GO Molecular Function: ferrous iron binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016701GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on single donors with incorporation of molecular oxygen SoyBaseN/AISS
PF02900PFAM Catalytic LigB subunit of aromatic ring-opening dioxygenase JGI ISS
UniRef100_G7KNT9UniRef Annotation by Michelle Graham. Most informative UniRef hit: 4,5-DOPA dioxygenase extradiol-like protein n=1 Tax=Medicago truncatula RepID=G7KNT9_MEDTR SoyBaseE_val: 1.00E-99ISS
UniRef100_UPI00023388E7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023388E7 related cluster n=1 Tax=unknown RepID=UPI00023388E7 SoyBaseE_val: 1.00E-129ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g28503 not represented in the dataset

Glyma09g28503 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g28503.1   sequence type=CDS   gene model=Glyma09g28503   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAAAGACGTGTTTCCTCAAAACCCATTTCAATACTTGTCATCTCTGCTCACTGTGACACTGCAGTTCCATCCATCAACGTTGTTGACTCCGTCAACCACACCATCTATGATTTCTATAACTTCCCCGAACAAATGTACCAGCATAAATATCCTGCACCTGGAGCTCCACAATTGGCAAGAAGGGTGAAGGAACTGCTCATAAAATCTGGTTTCAGCCGTGTTGATGAAGATACAAAGCCAGGACTTGACCATGGTGCTAGGGTTCCTCTCTTTTTGATGTATCCAGAAGCTGACATCCCTGTTTGTCAGCTATCTGTTCAATCTCAGCAAGATGGAACTTACCATTATAACTTTGGAAAGGCATTGGCACCTCTTAAAGATGAAAGTGTTTTGATTATTGCTCCCTGGGCTTTAGAATTTTATAATTGGTTGAAAGATGCTCTTCTTGAAGGAAGGGAATTATTTAGAAGTTCCTTAATTGGTTTGAAAGACTATTGTGACAGCGGAATGATGGTTTACTGCATAGATCTAATTACCATTTACCAAGATACAGCTCATCCCTGGCCGGATCACTTTTATCCTCTGCATGTTGCAATTGGTGCTGCTGGTGAAAATGCAAAGGTCAAACTTATACACAGCAGCATTGATCTGGGAACTCTCTCTTATGCATCTTACCAGTTTACATCAGCTGCCAGCTGA

>Glyma09g28503.1   sequence type=predicted peptide   gene model=Glyma09g28503   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEERRVSSKPISILVISAHCDTAVPSINVVDSVNHTIYDFYNFPEQMYQHKYPAPGAPQLARRVKELLIKSGFSRVDEDTKPGLDHGARVPLFLMYPEADIPVCQLSVQSQQDGTYHYNFGKALAPLKDESVLIIAPWALEFYNWLKDALLEGRELFRSSLIGLKDYCDSGMMVYCIDLITIYQDTAHPWPDHFYPLHVAIGAAGENAKVKLIHSSIDLGTLSYASYQFTSAAS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo