SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma09g27490

Feature Type:gene_model
Chromosome:Gm09
Start:34324793
stop:34326956
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G25420AT Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr4:12990982-12992409 REVERSE LENGTH=377 SoyBaseE_val: 0ISS
GO:0009686GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellin biosynthetic process SoyBaseN/AISS
GO:0009688GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid biosynthetic process SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009826GO-bp Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0016114GO-bp Annotation by Michelle Graham. GO Biological Process: terpenoid biosynthetic process SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0048575GO-bp Annotation by Michelle Graham. GO Biological Process: short-day photoperiodism, flowering SoyBaseN/AISS
GO:0048608GO-bp Annotation by Michelle Graham. GO Biological Process: reproductive structure development SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016706GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors SoyBaseN/AISS
GO:0045544GO-mf Annotation by Michelle Graham. GO Molecular Function: gibberellin 20-oxidase activity SoyBaseN/AISS
KOG0143 KOG Iron/ascorbate family oxidoreductases JGI ISS
PTHR10209Panther FE(II)/ ASCORBATE OXIDASE SUPERFAMILY JGI ISS
PTHR10209:SF55Panther OXIDOREDUCTASE, 2OG-FE(II) OXYGENASE FAMILY PROTEI JGI ISS
PF03171PFAM 2OG-Fe(II) oxygenase superfamily JGI ISS
UniRef100_I1L3G4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L3G4_SOYBN SoyBaseE_val: 0ISS
UniRef100_O04280UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin 20-oxidase n=1 Tax=Phaseolus vulgaris RepID=O04280_PHAVU SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma16g32550 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g149200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g27490.1   sequence type=CDS   gene model=Glyma09g27490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCATAGAGTGCATAACAAATATACAATCAATGTCTCAACCACAAAAGCACCACCAAGAGCACAAAGAAGATGAAGCACCATTGGTTTTTGATGCCTCACTTCTCAGGCACCAACTCAACCTACCAAAACAGTTCATTTGGCCTGATGAGGAAAAGCCATGCATGAATGTGCCTGAGCTTGGTGTCCCTCTCATTGACTTGGGGGGGTTCCTCTCTGGTGACCCTGTTGCAACAATGGAGGCTGCAAGGATAGTTGGTGAGGCATGCCAAAAGCATGGTTTCTTTCTTGTGGTGAACCATGGGATTGATGCCAACTTAATCTCTAATGCTCATAGCTACATGGATGACTTCTTTGAGGTTCCTCTGTCTCAGAAACAGAGGGCTCAGAGGAAAACAGGGGAACACTGTGGTTATGCTAGTAGCTTCACTGGCAGGTTCTCTTCAAAGCTTCCATGGAAAGAGACACTTTCTTTTCAGTACTCGGCTGAGGAAAATTCATCCACTATTGTCAAAGACTACTTGTGCAACACATTGGAGAAAGAGTTTGAGCAATTTGGGAGGGTTTACCAGGACTATTGTGATGCCATGAGCAATCTTTCTTTGGGGATAATGGAACTTTTGGGAATGAGTCTTGGAGTTGGTAAAGCATGTTTTAGAGAGTTCTTTGAAGAGAATAACTCAATAATGAGGCTCAATTACTACCCTCCTTGTCAAAAGCCTGACCTCACTTTGGGCACTGGACCTCACTGTGACCCAACATCTTTGACCATTCTTCACCAAGACCAAGTGGGAGGCCTCCAAGTTTTTGTTGACAATGAGTGGCATTCCATTAGCCCAAATTTCAATGCTTTTGTTGTCAACATAGGTGACACCTTCATGGCTCTTTCAAATGGAAGGTACAAGAGTTGCTTGCATAGGGCAGTGGTGAACAGCAAGACCACAAGAAAATCTCTTGCTTTCTTTTTGTGTCCAAAAGGTGATAAGGTGGTTAGTCCACCAAGTGAATTGGTGGATGATTTGACACCAAGGATATACCCTGATTTTACATGGCCTATGCTGCTTGAGTTTACTCAGAAACATTATAGAGCTGACATGAAAACCCTTGAGGCATTCACCAACTGGCTTCTTCAACGGAAAATGAGCTGA

>Glyma09g27490.1   sequence type=predicted peptide   gene model=Glyma09g27490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAIECITNIQSMSQPQKHHQEHKEDEAPLVFDASLLRHQLNLPKQFIWPDEEKPCMNVPELGVPLIDLGGFLSGDPVATMEAARIVGEACQKHGFFLVVNHGIDANLISNAHSYMDDFFEVPLSQKQRAQRKTGEHCGYASSFTGRFSSKLPWKETLSFQYSAEENSSTIVKDYLCNTLEKEFEQFGRVYQDYCDAMSNLSLGIMELLGMSLGVGKACFREFFEENNSIMRLNYYPPCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWHSISPNFNAFVVNIGDTFMALSNGRYKSCLHRAVVNSKTTRKSLAFFLCPKGDKVVSPPSELVDDLTPRIYPDFTWPMLLEFTQKHYRADMKTLEAFTNWLLQRKMS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo