Glyma09g27276 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g27276): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g27276): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g27276

Feature Type:	gene_model
Chromosome:	Gm09
Start:	34017839
stop:	34018962
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g27276

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G51310	AT	Annotation by Michelle Graham. TAIR10: transferases;tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferases \| chr1:19019185-19021735 REVERSE LENGTH=497	SoyBase	E_val: 5.00E-32	ISS
GO:0006396	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA processing	SoyBase	N/A	ISS
GO:0008033	GO-bp	Annotation by Michelle Graham. GO Biological Process: tRNA processing	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0004808	GO-mf	Annotation by Michelle Graham. GO Molecular Function: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase activity	SoyBase	N/A	ISS
GO:0016740	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity	SoyBase	N/A	ISS
PTHR11933	Panther	TRNA (5-METHYLAMINOMETHYL-2-THIOURIDYLATE)-METHYLTRANSFERASE	JGI		ISS
PF03054	PFAM	tRNA methyl transferase	JGI		ISS
UniRef100_B9RIE1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase, putative n=1 Tax=Ricinus communis RepID=B9RIE1_RICCO	SoyBase	E_val: 3.00E-30	ISS
UniRef100_I1LJW0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LJW0_SOYBN	SoyBase	E_val: 1.00E-33	ISS

Expression Patterns of Glyma09g27276

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g27276 not represented in the dataset	Glyma09g27276 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g27276 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g147800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g27276

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g27276

Limit To All Plant Sequences

>Glyma09g27276.1   sequence type=CDS   gene model=Glyma09g27276   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAAGTTTCAGCACCCGCAGCTGGTGACTTCCCTATTCTTGGTTCATCCTGCATCTACGGAGGCTTCGATAGCAGCTCTCTGGCTGCTCCACGCCGTCGGCCACTCCTGCACTGCTTTCTACCTCAAGATATTGTTCCAAAACTTTTGGTCTGAGTGCCCCTGGGAAGACGATTTAAAGTATGCTAAAGATGTTTGTAATCAGGTTGATGTACCGTTAGAAGTGGTTCATTTAACCGATGAATACTGGAACAATGTGGTACGCAAGACCGATTCAGCTACTTTTGTCCAATATTTTATTCACTTTCCCTTTATTAGGCAATAA

Predicted protein sequences of Glyma09g27276

Limit To All Plant Sequences

>Glyma09g27276.1   sequence type=predicted peptide   gene model=Glyma09g27276   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMKFQHPQLVTSLFLVHPASTEASIAALWLLHAVGHSCTAFYLKILFQNFWSECPWEDDLKYAKDVCNQVDVPLEVVHLTDEYWNNVVRKTDSATFVQYFIHFPFIRQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain