|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
ATCG00350 | AT | Annotation by Michelle Graham. TAIR10: Photosystem I, PsaA/PsaB protein | chrC:39605-41857 REVERSE LENGTH=750 | SoyBase | E_val: 2.00E-39 | ISS |
GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0009522 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: photosystem I | SoyBase | N/A | ISS |
GO:0009534 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid | SoyBase | N/A | ISS |
GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
GO:0009538 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: photosystem I reaction center | SoyBase | N/A | ISS |
GO:0009579 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid | SoyBase | N/A | ISS |
GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
GO:0010287 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
GO:0016021 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane | SoyBase | N/A | ISS |
GO:0016168 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding | SoyBase | N/A | ISS |
GO:0046872 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: metal ion binding | SoyBase | N/A | ISS |
PF00223 | PFAM | Photosystem I psaA/psaB protein | JGI | ISS | |
UniRef100_Q9TNK0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Photosystem I P700 apoprotein A1 (Fragment) n=1 Tax=Sphagnum fallax RepID=Q9TNK0_9BRYO | SoyBase | E_val: 1.00E-39 | ISS |
UniRef100_Q9TNK0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Photosystem I P700 apoprotein A1 (Fragment) n=1 Tax=Sphagnum fallax RepID=Q9TNK0_9BRYO | SoyBase | E_val: 1.00E-39 | ISS |
Glyma09g26731 not represented in the dataset |
Glyma09g26731 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g26731.1 sequence type=CDS gene model=Glyma09g26731 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GTTTTTAGTGCCCATTTCGGCCAACTTTCTATCATCTTTCTTTGGCTGAGTGGCATGTATTTTCATGGTGCTCGCTTTTTCAATTATGAGGCATGGTTAAGTGATCCTACTCGCATTAGGCCTAGTGCTCAGGTGATTTGGCCAATAGTGGGCCAAGAAATATTGAATGGTGATGTAGGGGGAGGGTTTCGAGGAATACAAATAACCTCCGATTATTTTTAG
>Glyma09g26731.1 sequence type=predicted peptide gene model=Glyma09g26731 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high VFSAHFGQLSIIFLWLSGMYFHGARFFNYEAWLSDPTRIRPSAQVIWPIVGQEILNGDVGGGFRGIQITSDYF*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||