Glyma09g26480 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g26480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g26480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g26480

Feature Type:	gene_model
Chromosome:	Gm09
Start:	32938985
stop:	32940633
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g26480

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G24360	AT	Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein \| chr1:8640820-8643283 FORWARD LENGTH=319	SoyBase	E_val: 2.00E-59	ISS
GO:0000038	GO-bp	Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process	SoyBase	N/A	ISS
GO:0006633	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0042335	GO-bp	Annotation by Michelle Graham. GO Biological Process: cuticle development	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0004316	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0051287	GO-mf	Annotation by Michelle Graham. GO Molecular Function: NAD binding	SoyBase	N/A	ISS
KOG1199	KOG	Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase	JGI		ISS
PTHR24316	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24316:SF88	Panther		JGI		ISS
PF00106	PFAM	short chain dehydrogenase	JGI		ISS
UniRef100_B9RAK4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Short chain type dehydrogenase, putative n=1 Tax=Ricinus communis RepID=B9RAK4_RICCO	SoyBase	E_val: 2.00E-67	ISS
UniRef100_UPI0002338743	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002338743 related cluster n=1 Tax=unknown RepID=UPI0002338743	SoyBase	E_val: 3.00E-93	ISS

Expression Patterns of Glyma09g26480

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g26480 not represented in the dataset	Glyma09g26480 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g26480 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g143100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g26480

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g26480

Limit To All Plant Sequences

>Glyma09g26480.2   sequence type=CDS   gene model=Glyma09g26480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTAGAACTGTAGTTGATGCTTGGGGAACTGTTGATGTATTGGTAAATAATGCAGTAATTACTCAAGATGGTTTGTTAATGAGAATGAAGAAATCACAATGGCAGGAAGTTATTAATCTGAATCTCACTAGTGTTTTTCTTTGCATGCAGGCAGCAGCAAAGATTATGACGATGAAAAAGAAGGGAAGGATAATCAATATTACATTAGTTATTGGTCAGGTTGCCAATGTTGGACAAGCCAATTATAGTGCTGCAAAGGCAGGGGTAATTGGCCTCACAAAAAGTGTTGCCAGGGAATATGCTAGCAGAAACATCACTCTTAATACTTTCACCTTGGATTCAGGAAGACTTGGCCTACTAGAAGAAGTTGTTGGACTTGTGGAATTCTTGGCTCTTAATCCTGCTGCCAATACATCATTGGGCAGGGTGTTCACCGTTGATGGAGGTATGGCAATGTAA

Predicted protein sequences of Glyma09g26480

Limit To All Plant Sequences

>Glyma09g26480.2   sequence type=predicted peptide   gene model=Glyma09g26480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIRTVVDAWGTVDVLVNNAVITQDGLLMRMKKSQWQEVINLNLTSVFLCMQAAAKIMTMKKKGRIINITLVIGQVANVGQANYSAAKAGVIGLTKSVAREYASRNITLNTFTLDSGRLGLLEEVVGLVEFLALNPAANTSLGRVFTVDGGMAM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain