|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G42280 | AT | Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein | chr2:17611891-17613163 REVERSE LENGTH=300 | SoyBase | E_val: 9.00E-19 | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0046685 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to arsenic-containing substance | SoyBase | N/A | ISS |
| GO:0048573 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| UniRef100_G7IE46 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bHLH130 n=1 Tax=Medicago truncatula RepID=G7IE46_MEDTR | SoyBase | E_val: 1.00E-37 | ISS |
| UniRef100_I1LQH3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LQH3_SOYBN | SoyBase | E_val: 3.00E-63 | ISS |
|
Glyma09g25281 not represented in the dataset |
Glyma09g25281 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g137400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g25281.1 sequence type=CDS gene model=Glyma09g25281 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high CTAATGTCATCAAGGCCTGAAATTGGAAACAAGAGCAAAACACAGAACAATGCAGAAAATGAAGGGTTTGCTGAAAGCCAGGGCAATGAAGTTATCCCTACAGGTCTGAAGAGATTTAGAGATGAAGATGTGAAACCATTTTCTGGTTTAAATGCACCTGAAAGTCAGAATGAAATTAGAGGCCAACAACCTTCTTCTTCTGCTTTGGCTCATCAATTGAGTTTGCCAAACACTTCTGCAGAAATGACAGCCATTGAGAAGTTTCTTCAACTCTCGGATTTTGTTCCTAGCAAAATTCGTGCCAAGCGGGGCTGTGCCACTCACCCTAGAAGCATTGCAGAGAAGGTATGA
>Glyma09g25281.1 sequence type=predicted peptide gene model=Glyma09g25281 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high LMSSRPEIGNKSKTQNNAENEGFAESQGNEVIPTGLKRFRDEDVKPFSGLNAPESQNEIRGQQPSSSALAHQLSLPNTSAEMTAIEKFLQLSDFVPSKIRAKRGCATHPRSIAEKV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||