Glyma09g25028 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g25028): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g25028): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g25028

Feature Type:	gene_model
Chromosome:	Gm09
Start:	31094433
stop:	31094909
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g25028

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G26140	AT	Annotation by Michelle Graham. TAIR10: Cellulase (glycosyl hydrolase family 5) protein \| chr3:9559742-9563070 REVERSE LENGTH=508	SoyBase	E_val: 3.00E-57	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004553	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds	SoyBase	N/A	ISS
GO:0043169	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cation binding	SoyBase	N/A	ISS
PF00150	PFAM	Cellulase (glycosyl hydrolase family 5)	JGI		ISS
UniRef100_B9RMT6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Hydrolase, hydrolyzing O-glycosyl compounds, putative n=1 Tax=Ricinus communis RepID=B9RMT6_RICCO	SoyBase	E_val: 5.00E-70	ISS
UniRef100_I1KSV8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KSV8_SOYBN	SoyBase	E_val: 4.00E-104	ISS

Expression Patterns of Glyma09g25028

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g25028 not represented in the dataset	Glyma09g25028 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g25028 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g135500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g25028

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g25028

Limit To All Plant Sequences

>Glyma09g25028.1   sequence type=CDS   gene model=Glyma09g25028   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAAGGGAGCAGAAGCTGTTCATGCAGCAAATCCAGATGTTCTAGTCATTCTATCTGGGCTAAATTTTGACACAAGCTTGTCATTCATTCGGGATAGACCAGTGAGCCTCACGTTCAAAGGGAAGCTAGTATTTGAGGTGCACAGGTATGGCTTCACTGATGGTGGAGCTTGGGCTGATGGGAACCCAAACCAAGTATATGGAAAAGTGACAGCAGATATAAAGCAAACATCTACCTTCTTAGTGGACCAAGGATGGCCATTGTTTGTGAGTGAATTTGGTGGAGACTTGAGAGGTACCAATGTGAATGGCAATCGATACCTTAACTGTTTTCTGGCACTGGTAGCTGAGCTTGACTTGGATTGGGCCTATTGGACTCTTGTTGGTAGTTACTACTTTAGAGAAGGGGTTATAGGAATGGAAGAGTTTTATGGCCTTCTCACTTGGGATTGGACTCAGATTACAAGAGTGTAA

Predicted protein sequences of Glyma09g25028

Limit To All Plant Sequences

>Glyma09g25028.1   sequence type=predicted peptide   gene model=Glyma09g25028   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKGAEAVHAANPDVLVILSGLNFDTSLSFIRDRPVSLTFKGKLVFEVHRYGFTDGGAWADGNPNQVYGKVTADIKQTSTFLVDQGWPLFVSEFGGDLRGTNVNGNRYLNCFLALVAELDLDWAYWTLVGSYYFREGVIGMEEFYGLLTWDWTQITRV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain