Glyma09g24851 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g24851): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g24851): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g24851

Feature Type:	gene_model
Chromosome:	Gm09
Start:	30794292
stop:	30795044
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g24851

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G73430	AT	Annotation by Michelle Graham. TAIR10: sec34-like family protein \| chr1:27604096-27610829 FORWARD LENGTH=784	SoyBase	E_val: 5.00E-33	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005801	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cis-Golgi network	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR13302	Panther	CONSERVED OLIGOMERIC GOLGI COMPLEX COMPONENT 3	JGI		ISS
UniRef100_G7JS38	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Conserved oligomeric Golgi complex subunit n=1 Tax=Medicago truncatula RepID=G7JS38_MEDTR	SoyBase	E_val: 2.00E-36	ISS
UniRef100_UPI0002338453	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002338453 related cluster n=1 Tax=unknown RepID=UPI0002338453	SoyBase	E_val: 2.00E-49	ISS

Expression Patterns of Glyma09g24851

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g24851 not represented in the dataset	Glyma09g24851 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g24851 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g134300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g24851

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g24851

Limit To All Plant Sequences

>Glyma09g24851.1   sequence type=CDS   gene model=Glyma09g24851   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCGTTCTAATGCACTTGTTGTTCTGAAAGGTGCCTCTTCTCAGTTCCAGGAAGCAATCCGTGGAAGTGGTGGTGGCAAAGCATGTATCTCTGAGGGAGTGGAGGCATTCGTGATATATGTTCGGTTCAAGGTAGCAACAAGTGAACTTAAGCCACTACTTGAAGAGATTGAAAGTAGGTCTTCAAGGAAAGAATATGGTCAAATTCTGGCAGAATGCCACAGACTATACTGTGAGCAATGCCTCTCTTTGAAGGCTATTAACTTCTCTAATGGCTAA

Predicted protein sequences of Glyma09g24851

Limit To All Plant Sequences

>Glyma09g24851.1   sequence type=predicted peptide   gene model=Glyma09g24851   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRSNALVVLKGASSQFQEAIRGSGGGKACISEGVEAFVIYVRFKVATSELKPLLEEIESRSSRKEYGQILAECHRLYCEQCLSLKAINFSNG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain