Glyma09g24070 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g24070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g24070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g24070

Feature Type:	gene_model
Chromosome:	Gm09
Start:	29720959
stop:	29724241
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g24070

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G52840	AT	Annotation by Michelle Graham. TAIR10: NADH-ubiquinone oxidoreductase-related \| chr5:21413718-21414794 FORWARD LENGTH=169	SoyBase	E_val: 5.00E-91	ISS
GO:0006098	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt	SoyBase	N/A	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0022904	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory electron transport chain	SoyBase	N/A	ISS
GO:0051788	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to misfolded protein	SoyBase	N/A	ISS
GO:0080129	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0005747	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0031966	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial membrane	SoyBase	N/A	ISS
GO:0045271	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: respiratory chain complex I	SoyBase	N/A	ISS
GO:0016651	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H	SoyBase	N/A	ISS
KOG3365	KOG	NADH:ubiquinone oxidoreductase, NDUFA5/B13 subunit	JGI		ISS
PTHR12653	Panther	NADH-UBIQUINONE OXIDOREDUCTASE 13 KD-B SUBUNIT	JGI		ISS
PF04716	PFAM	ETC complex I subunit conserved region	JGI		ISS
UniRef100_B9RIR5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NADH dehydrogenase, putative n=1 Tax=Ricinus communis RepID=B9RIR5_RICCO	SoyBase	E_val: 2.00E-96	ISS
UniRef100_C6T2Y2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2Y2_SOYBN	SoyBase	E_val: 5.00E-117	ISS

Expression Patterns of Glyma09g24070

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g24070 not represented in the dataset	Glyma09g24070 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g24070 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g129000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g24070

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g24070

Limit To All Plant Sequences

>Glyma09g24070.1   sequence type=CDS   gene model=Glyma09g24070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTCTGCGTGCGGTGGCGCGGCCGTTGATGGCGAAGGTGAAGGCTTCGACGGGGATCGTGGGGCTGGACGTGGTGCCGAACGCGAGGGAGGTGCTGATTGGGCTGTACAGCAAGACGCTGAAAGAGATCCAGAAGGTTCCCGAAGATGAAGGGTACCGCAAGGCCGTGGAGAGCTTCACCAAGCACAGGCTCGGCGTGTGCAAGGAGGAGGAGGACTGGGAGAACATCGAGAAACGCCTCGGCTGCGGCCAGGTCGAGGAGCTCATCGAAGAGGCTCAGGACGAGCTCAAGCTCATTTCCTACATGATCGAGTGGGATCCTTGGGGTGTTCCAGATGATTATGAATGTGAGGTGATTGAGAATGATGCACCAGTTCCCAAGCATGTTCCTCTCCACCGACCTCCTCCTCTCCCAACAGAATTTCACAAGACGCTAGAGGCACTTACAGGGAAAGATACTCCGGCTGCCAGCTCTAGTGAATCACCCTCAAAGGCATGA

Predicted protein sequences of Glyma09g24070

Limit To All Plant Sequences

>Glyma09g24070.1   sequence type=predicted peptide   gene model=Glyma09g24070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFLRAVARPLMAKVKASTGIVGLDVVPNAREVLIGLYSKTLKEIQKVPEDEGYRKAVESFTKHRLGVCKEEEDWENIEKRLGCGQVEELIEEAQDELKLISYMIEWDPWGVPDDYECEVIENDAPVPKHVPLHRPPPLPTEFHKTLEALTGKDTPAASSSESPSKA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain