SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g23980): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g23980): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g23980

Feature Type:gene_model
Chromosome:Gm09
Start:29569623
stop:29573955
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G11260AT Annotation by Michelle Graham. TAIR10: phosphatase-related | chr4:6851515-6853719 REVERSE LENGTH=358 SoyBaseE_val: 4.00E-159ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009734GO-bp Annotation by Michelle Graham. GO Biological Process: auxin mediated signaling pathway SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010187GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of seed germination SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030163GO-bp Annotation by Michelle Graham. GO Biological Process: protein catabolic process SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:2000072GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0019005GO-cc Annotation by Michelle Graham. GO Cellular Compartment: SCF ubiquitin ligase complex SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG1309 KOG Suppressor of G2 allele of skp1 JGI ISS
PTHR22904Panther CHAPERONE BINDING PROTEIN JGI ISS
PTHR22904:SF69Panther SUBFAMILY NOT NAMED JGI ISS
PF00515PFAM Tetratricopeptide repeat JGI ISS
PF04969PFAM CS domain JGI ISS
PF05002PFAM SGS domain JGI ISS
UniRef100_B6EBD5UniRef Annotation by Michelle Graham. Most informative UniRef hit: SGT1-2 n=1 Tax=Glycine max RepID=B6EBD5_SOYBN SoyBaseE_val: 0ISS
UniRef100_B6EBD5UniRef Annotation by Michelle Graham. Best UniRef hit: SGT1-2 n=1 Tax=Glycine max RepID=B6EBD5_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g23980 not represented in the dataset

Glyma09g23980 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma16g29450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g128800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g23980.1   sequence type=CDS   gene model=Glyma09g23980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCGATCTCGAAGCAAAAGCCAAAGAGGCCTTCGTCGAAGACCACTTCGAACTCGCCGTGGACCTTCTCTCTCAGGCCATTCATCTCGAACCCAACAAAGCCGAATTCTACGCCGACCGCGCCCAAGCCAACATCAAACTCAACAACTTCACTGAGGCTGTGGCTGATGCTAACAAAGCAATTGAATTGAATCCTTCTCTACCAAAAGCATATTTGCGGAAAGGTACTGCTTGCATGAAGCTTGAGGAATATGAAACTGCAAAGGCTGCTCTGGAGGTGGGTGCATCATTGTCTCCAGACAACTCAAGGTTTGCTACTTTGATCAAAGAATGTGATAAGCTCATTGCAGAAGAATCTTATACCCCACCTATTATAGAGGAAAAGGCCACAACAGAAGATGTTACTCCAAAAGATGTTCAGCAACAAGATGATCTTCTAGAGAAGCCAACAGTTACAGTGACTAAACCTAAATATAGGCATGAATTCTACCAGAAACATGATCAGGTGGTTGTGACCATATTTGCAAAGAAAATCCCAAAGGAAAGCATTACTGTTGACTTCGGTGAACAAATACTAAGTGTTAGTATTAATGTCACAGGAGAAGACACATATGTTTTTCAACCTCGCTTATTTGGAAAGATCATACCTTCCAATTGTCAATATGAAGTTTTGTCCACCAAAATTGAAATTCGTCTTGCAAAAGCAGAACCTATTCACTGGACATCTCTAGAATTCACCAGAGACATCGTTGTTCAACAGAGGGTTAATGCTTCTTCAGTTACTGGAAGTCAAAGACCTTCTTACCCATCCTCAAAACAAACAAGAGATTGGGACAAGATTGAAGCTCAAGTCAAGAAAGAGGAGAAAGATGAAAAGCTTGATGGCGATGCTGCATTGAACAAATTTTTCCGCGAAATATATCAAGATGCAGATGAGGATACAAGAAGAGCAATGAAAAAGTCATTTGTTGAGTCTAATGGGACAGTTCTGTCTACAAACTGGAAAGAAGTGGGAACAAAGAAGGTAGAGGGAAGTCCTCCTGATGGCATGGAGTTGAAGAAATGGGAATATTAA

>Glyma09g23980.1   sequence type=predicted peptide   gene model=Glyma09g23980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASDLEAKAKEAFVEDHFELAVDLLSQAIHLEPNKAEFYADRAQANIKLNNFTEAVADANKAIELNPSLPKAYLRKGTACMKLEEYETAKAALEVGASLSPDNSRFATLIKECDKLIAEESYTPPIIEEKATTEDVTPKDVQQQDDLLEKPTVTVTKPKYRHEFYQKHDQVVVTIFAKKIPKESITVDFGEQILSVSINVTGEDTYVFQPRLFGKIIPSNCQYEVLSTKIEIRLAKAEPIHWTSLEFTRDIVVQQRVNASSVTGSQRPSYPSSKQTRDWDKIEAQVKKEEKDEKLDGDAALNKFFREIYQDADEDTRRAMKKSFVESNGTVLSTNWKEVGTKKVEGSPPDGMELKKWEY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo