SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g23706): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g23706): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g23706

Feature Type:gene_model
Chromosome:Gm09
Start:29338260
stop:29340652
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16520AT Annotation by Michelle Graham. TAIR10: UDP-glucosyl transferase 88A1 | chr3:5618847-5620833 REVERSE LENGTH=446 SoyBaseE_val: 2.00E-67ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0008194GO-mf Annotation by Michelle Graham. GO Molecular Function: UDP-glycosyltransferase activity SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
GO:0016758GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups SoyBaseN/AISS
GO:0080043GO-mf Annotation by Michelle Graham. GO Molecular Function: quercetin 3-O-glucosyltransferase activity SoyBaseN/AISS
GO:0080044GO-mf Annotation by Michelle Graham. GO Molecular Function: quercetin 7-O-glucosyltransferase activity SoyBaseN/AISS
GO:0080045GO-mf Annotation by Michelle Graham. GO Molecular Function: quercetin 3'-O-glucosyltransferase activity SoyBaseN/AISS
GO:0080046GO-mf Annotation by Michelle Graham. GO Molecular Function: quercetin 4'-O-glucosyltransferase activity SoyBaseN/AISS
KOG1192 KOG UDP-glucuronosyl and UDP-glucosyl transferase JGI ISS
PTHR11926Panther GLUCOSYL/GLUCURONOSYL TRANSFERASES JGI ISS
PTHR11926:SF15Panther UDP-GLUCURONOSYLTRANSFERASE RELATED JGI ISS
PF00201PFAM UDP-glucoronosyl and UDP-glucosyl transferase JGI ISS
UniRef100_A6BM07UniRef Annotation by Michelle Graham. Most informative UniRef hit: UDP-glucose:isoflavone 7-O-glucosyltransferase n=1 Tax=Glycine max RepID=A6BM07_SOYBN SoyBaseE_val: 6.00E-154ISS
UniRef100_UPI00023382DAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023382DA related cluster n=1 Tax=unknown RepID=UPI00023382DA SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g23706 not represented in the dataset

Glyma09g23706 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g23706.1   sequence type=CDS   gene model=Glyma09g23706   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAGACACCATTGTTCTATACCCTAATCTTGGTAGGGGACACCTAGTCTCCATGGTGGAGCTAGGAAAACTCATTCTAACCCAGTACCCTTCACTTTCCATCACTATACTCATCCTCACTCCTCCCATCACCCCTTCCACCACTACCATCGCATGCGACTCTAATGCTAGATACATCACCACTGTCACCGCCACCACCCCCGCCATCACGTTCCACCACGTCCCCTTCAACTTTAACACCCCCTCCCTCCCCCTTCACATCCTCTCCCTCGAATTCACCCGCCACAGCACGCAAAACATCACCGTTGCACTCCAAACCCTCGCCAAAGCCTCGAACCTCAAAGCCCTCGTCATGGACTTCATGAACTTCAATGACCCCAAAGCCCTCACCAAAAATCTCAACAACAACGTCCCCATTTACTTCTACTACACTTCTTGCGCCTCCACTCTCTCTACTCCTTCGTTCTACCAGGCCCTGCTTCAGTTACCGGAAAACATGGAGGATGGTGTTGGGATTATCACAAACACCTTTGAAGGGATTGAAGAAAAACCTATCAGAACATTAAGCAAGGATGTGACGATACCACCCTTGTTTTGTGTCAGACCCATGATTTCTGCACCCGTCGTATTGCTCTGTTATGGAAGCATGGGAAGGTTCTCGAGGGCTCAGTTGAAGGAGATTGCTCTTGGGTTGGAGAAGAGCGAGCAAAGGTTCTTGTGGGTCGCCCCACAGGTTCAGATACTGAGTCATGACTCGGTGGGTGGGTTCGTGACTCACTGCGGTTGGAACTTGGTGTTGGAGGCGATGTGTGAAGGGGTGCCAATGGTGGTGTGGCCTCTCTACACAGAGCAGAAGATGAATAGAGTGATTCTGGTGAAGGAAATAAAGGTGGCTTTGGCGGTGAATGAGAACAAAGAAGGGTTCGTGAGTGTGACAGAGTTGGTGAAGGGGTGCCAATGGTGGCGTGGCCTCTCTACGCAGAGTAGAAGATGA

>Glyma09g23706.1   sequence type=predicted peptide   gene model=Glyma09g23706   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKDTIVLYPNLGRGHLVSMVELGKLILTQYPSLSITILILTPPITPSTTTIACDSNARYITTVTATTPAITFHHVPFNFNTPSLPLHILSLEFTRHSTQNITVALQTLAKASNLKALVMDFMNFNDPKALTKNLNNNVPIYFYYTSCASTLSTPSFYQALLQLPENMEDGVGIITNTFEGIEEKPIRTLSKDVTIPPLFCVRPMISAPVVLLCYGSMGRFSRAQLKEIALGLEKSEQRFLWVAPQVQILSHDSVGGFVTHCGWNLVLEAMCEGVPMVVWPLYTEQKMNRVILVKEIKVALAVNENKEGFVSVTELVKGCQWWRGLSTQSRR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo