Glyma09g23671 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g23671): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g23671): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g23671

Feature Type:	gene_model
Chromosome:	Gm09
Start:	29287721
stop:	29301299
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g23671

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G51860	AT	Annotation by Michelle Graham. TAIR10: cation exchanger 3 \| chr3:19239458-19242519 FORWARD LENGTH=459	SoyBase	E_val: 8.00E-22	ISS
GO:0006793	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphorus metabolic process	SoyBase	N/A	ISS
GO:0006812	GO-bp	Annotation by Michelle Graham. GO Biological Process: cation transport	SoyBase	N/A	ISS
GO:0006814	GO-bp	Annotation by Michelle Graham. GO Biological Process: sodium ion transport	SoyBase	N/A	ISS
GO:0006816	GO-bp	Annotation by Michelle Graham. GO Biological Process: calcium ion transport	SoyBase	N/A	ISS
GO:0006874	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular calcium ion homeostasis	SoyBase	N/A	ISS
GO:0006882	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular zinc ion homeostasis	SoyBase	N/A	ISS
GO:0009624	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to nematode	SoyBase	N/A	ISS
GO:0010351	GO-bp	Annotation by Michelle Graham. GO Biological Process: lithium ion transport	SoyBase	N/A	ISS
GO:0030026	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular manganese ion homeostasis	SoyBase	N/A	ISS
GO:0051592	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to calcium ion	SoyBase	N/A	ISS
GO:0055062	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphate ion homeostasis	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0009705	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008324	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cation transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015368	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calcium:cation antiporter activity	SoyBase	N/A	ISS
GO:0015369	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calcium:hydrogen antiporter activity	SoyBase	N/A	ISS
GO:0015491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cation transport	SoyBase	N/A	ISS
UniRef100_G7KE49	UniRef	Annotation by Michelle Graham. Best UniRef hit: Vacuolar cation/proton exchanger n=1 Tax=Medicago truncatula RepID=G7KE49_MEDTR	SoyBase	E_val: 9.00E-24	ISS
UniRef100_G7KE49	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar cation/proton exchanger n=1 Tax=Medicago truncatula RepID=G7KE49_MEDTR	SoyBase	E_val: 9.00E-24	ISS

Expression Patterns of Glyma09g23671

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g23671 not represented in the dataset	Glyma09g23671 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g23671 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g128000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g23671

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g23671

Limit To All Plant Sequences

>Glyma09g23671.1   sequence type=CDS   gene model=Glyma09g23671   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGGACATATCGTTGGGTGTTACTATGGGATCTGCAACTCAAATTTCTATGTTTGTGGTTCCATTAAGTGTATTTGTTGCATGGATAATGGGTATAAGAATGGATTCGGACTTCAATCTTCTTGAAACTAGATGTCTATCTTTTACAATTATAATTACAATGTTCACTTTACAGGTATGCACAATGCCTTCTATATAA

Predicted protein sequences of Glyma09g23671

Limit To All Plant Sequences

>Glyma09g23671.1   sequence type=predicted peptide   gene model=Glyma09g23671   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQDISLGVTMGSATQISMFVVPLSVFVAWIMGIRMDSDFNLLETRCLSFTIIITMFTLQVCTMPSI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain