SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma09g23631

Feature Type:gene_model
Chromosome:Gm09
Start:29213233
stop:29215641
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G27450AT Annotation by Michelle Graham. TAIR10: adenine phosphoribosyl transferase 1 | chr1:9532421-9533807 FORWARD LENGTH=183 SoyBaseE_val: 9.00E-18ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006168GO-bp Annotation by Michelle Graham. GO Biological Process: adenine salvage SoyBaseN/AISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0009116GO-bp Annotation by Michelle Graham. GO Biological Process: nucleoside metabolic process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003999GO-mf Annotation by Michelle Graham. GO Molecular Function: adenine phosphoribosyltransferase activity SoyBaseN/AISS
PTHR11776Panther PHOSPHORIBOSYLTRANSFERASE JGI ISS
UniRef100_B9RP26UniRef Annotation by Michelle Graham. Most informative UniRef hit: Adenine phosphoribosyltransferase, putative n=1 Tax=Ricinus communis RepID=B9RP26_RICCO SoyBaseE_val: 4.00E-18ISS
UniRef100_C6SXZ1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SXZ1_SOYBN SoyBaseE_val: 3.00E-19ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g23631 not represented in the dataset

Glyma09g23631 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g127800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g23631.1   sequence type=CDS   gene model=Glyma09g23631   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTTTATGTTTAGGTGAAGTAATTTCACAAAAATATGCTCTAGAATATGGAACTGCTTGCTTGGAGTTGCATGTTGGTTCTGTCCAACCCGGTGAACGGGCCATAATCATTGATGACTTGGTGGCCACAGATGGAACTCTGTCAGCAAGAAACGTGTTGGTGCTGAAGTGGTGGAATGTGCTTGTGTCATTGGTGTGCCTGATGTCAAGGGGTAGTGCAGGTGTATTGGAAAGCCACTTTATGTTCTTATTGAGCCGCGTAAAGCGGATAAATGTTACTGAGCTGAGATTGTCATACACAAAATATTTTACTACATGA

>Glyma09g23631.1   sequence type=predicted peptide   gene model=Glyma09g23631   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLCLGEVISQKYALEYGTACLELHVGSVQPGERAIIIDDLVATDGTLSARNVLVLKWWNVLVSLVCLMSRGSAGVLESHFMFLLSRVKRINVTELRLSYTKYFTT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo