SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g23620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g23620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g23620

Feature Type:gene_model
Chromosome:Gm09
Start:29117853
stop:29119136
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g23620
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G39790AT Annotation by Michelle Graham. TAIR10: 5'-AMP-activated protein kinase-related | chr5:15932884-15935121 REVERSE LENGTH=273 SoyBaseE_val: 6.00E-35ISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0030247GO-mf Annotation by Michelle Graham. GO Molecular Function: polysaccharide binding SoyBaseN/AISS
UniRef100_I1LMD3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LMD3_SOYBN SoyBaseE_val: 1.00E-47ISS
UniRef100_Q94AX2UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT5g39790/MKM21_80 n=1 Tax=Arabidopsis thaliana RepID=Q94AX2_ARATH SoyBaseE_val: 3.00E-32ISS

Expression Patterns of Glyma09g23620
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g23620 not represented in the dataset
Glyma09g23620 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g23620 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma09g23620
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g23620
>Glyma09g23620.1   sequence type=CDS   gene model=Glyma09g23620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCCTTGGCCAGATTAGTAGAAGAAATAGCTCAATGTGGTATTCCAGAAGGTTCAAGGAAGATCAATGGAAAGTACATTCATTCTCACCTTGTTGCTAGATTAGAAGGAAAAAATAAAGGATGTCGGTACGACATAATCAAAGGAGGTTTCGGTGTTTTGGAAAATGTATCCCATAAAATATATATGGCATCCTTGCTTGCGAAGACTGATACTAATAGTGTGCAAGTTATGGGCACCTTTGATGGCTGGAGCCAAGGGGAGCACCTTTCACCTAAGTATACTAGTTCTTACACAAGGTTTTCAACTACATTGTTGCTTAGGCCAGGAAGCTACTATTTTTTTTATGAAATCAAATTCTTAGTAGATGGGTTAACCAAAAATAATTTGCTAGTTGTTGAGTAA
Predicted protein sequences of Glyma09g23620
>Glyma09g23620.1   sequence type=predicted peptide   gene model=Glyma09g23620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ALARLVEEIAQCGIPEGSRKINGKYIHSHLVARLEGKNKGCRYDIIKGGFGVLENVSHKIYMASLLAKTDTNSVQVMGTFDGWSQGEHLSPKYTSSYTRFSTTLLLRPGSYYFFYEIKFLVDGLTKNNLLVVE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo