SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g23420): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g23420): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g23420

Feature Type:gene_model
Chromosome:Gm09
Start:29004040
stop:29006163
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g23420
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G49510AT Annotation by Michelle Graham. TAIR10: embryo defective 1273 | chr1:18327026-18328147 FORWARD LENGTH=240 SoyBaseE_val: 1.00E-27ISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_D7KEY0UniRef Annotation by Michelle Graham. Most informative UniRef hit: EMB1273 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KEY0_ARALL SoyBaseE_val: 4.00E-25ISS
UniRef100_UPI0002338481UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338481 related cluster n=1 Tax=unknown RepID=UPI0002338481 SoyBaseE_val: 6.00E-40ISS

Expression Patterns of Glyma09g23420
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g23420 not represented in the dataset
Glyma09g23420 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g23420 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma09g23420
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Transcripts of Glyma09g23420
>Glyma09g23420.2   sequence type=transcript   gene model=Glyma09g23420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTACCTCCCTAAGTGAAATGTCGTACTGTGCACATGAAAGGAAGCTAGTCTTTGTTCCTCTTACGGTTCCCTTTGGAGTTGCTGTGGCTAGGATCCTTAAAGAGACTGCCCTTCAGTTATCTCCACGTCTAAGGGATTCAGAAGTTCCATGGAATTTAATTGCCATTGCAATTTTCTTCACATTGATCAAATTGCCTGGACCATATTACCCTTACTGAGTACGTATAATTATTCCTTATTTTGCAAATGGGGTTCTGTTGAGAACTCTATTGTTTGCAATATTGTGGTATAGAAGACCTAAAGCATTGAAGATGTTGGATTCTAGTTAGTTAACTCACTGAGTTATGATACTTGTTGCCTGCAAAGTCAATTTCAGTTGT
Coding sequences of Glyma09g23420
>Glyma09g23420.1   sequence type=CDS   gene model=Glyma09g23420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGTACTGTGCACATGAAAGGAAGCTAGTCTTTGTTCCTCTTACGGTTCCCTTTGGAGTTGCTGTGGCTAGGATCCTTAAAGAGACTGCCCTTCAGTTATCTCCACGTCTAAGGGATTCAGAAGTTCCATGGAATTTAATTGCCATTGCAATTTTCTTCACATTGATCAAATTGCCTGGACCATATTACCCTTACTGA

>Glyma09g23420.2   sequence type=CDS   gene model=Glyma09g23420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGTACTGTGCACATGAAAGGAAGCTAGTCTTTGTTCCTCTTACGGTTCCCTTTGGAGTTGCTGTGGCTAGGATCCTTAAAGAGACTGCCCTTCAGTTATCTCCACGTCTAAGGGATTCAGAAGTTCCATGGAATTTAATTGCCATTGCAATTTTCTTCACATTGATCAAATTGCCTGGACCATATTACCCTTACTGA
Predicted protein sequences of Glyma09g23420
>Glyma09g23420.1   sequence type=predicted peptide   gene model=Glyma09g23420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSYCAHERKLVFVPLTVPFGVAVARILKETALQLSPRLRDSEVPWNLIAIAIFFTLIKLPGPYYPY*

>Glyma09g23420.2   sequence type=predicted peptide   gene model=Glyma09g23420   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSYCAHERKLVFVPLTVPFGVAVARILKETALQLSPRLRDSEVPWNLIAIAIFFTLIKLPGPYYPY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo