SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g23191): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g23191): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g23191

Feature Type:gene_model
Chromosome:Gm09
Start:28567038
stop:28567564
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g23191
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G16490AT Annotation by Michelle Graham. TAIR10: ARM repeat superfamily protein | chr4:9293891-9295530 REVERSE LENGTH=472 SoyBaseE_val: 6.00E-30ISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
PTHR23315Panther BETA CATENIN-RELATED ARMADILLO REPEAT-CONTAINING JGI ISS
PTHR23315:SF33Panther OS07G0584900 PROTEIN JGI ISS
UniRef100_A5C9T4UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5C9T4_VITVI SoyBaseE_val: 2.00E-33ISS
UniRef100_B9SQF9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin-protein ligase, putative n=1 Tax=Ricinus communis RepID=B9SQF9_RICCO SoyBaseE_val: 7.00E-32ISS

Expression Patterns of Glyma09g23191
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g23191 not represented in the dataset
Glyma09g23191 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g23191 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g126600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g23191
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g23191
>Glyma09g23191.1   sequence type=CDS   gene model=Glyma09g23191   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGTTGGCGAAGAAGCGAGCCGACAACCTCGCTCTGATCGACGAGTCCGGAGCGGTGGCGGCTCTGATTCCGCTGCTCTGGTGCAGCGATTCGTGGACGCAGGAACACGCGGTGAAAGCGTTGCTGAACCTGTCTCTTTTGGAAGAGAACAAGGCGCTTATAACGAATGCGGGTGCGGTGAAGTCGCTAATATACGTGCTGAAAAGAGGGACGAAGACTTCGAAGCAGAACGCGGTGTTAGTTTCTTGTTGA
Predicted protein sequences of Glyma09g23191
>Glyma09g23191.1   sequence type=predicted peptide   gene model=Glyma09g23191   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQLAKKRADNLALIDESGAVAALIPLLWCSDSWTQEHAVKALLNLSLLEENKALITNAGAVKSLIYVLKRGTKTSKQNAVLVSC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo