SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g23136): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g23136): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g23136

Feature Type:gene_model
Chromosome:Gm09
Start:28483643
stop:28485091
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G24090AT Annotation by Michelle Graham. TAIR10: chitinase A | chr5:8143805-8145153 REVERSE LENGTH=302 SoyBaseE_val: 3.00E-109ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009642GO-bp Annotation by Michelle Graham. GO Biological Process: response to light intensity SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016926GO-bp Annotation by Michelle Graham. GO Biological Process: protein desumoylation SoyBaseN/AISS
GO:0042631GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation SoyBaseN/AISS
GO:0050665GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0043169GO-mf Annotation by Michelle Graham. GO Molecular Function: cation binding SoyBaseN/AISS
PF00704PFAM Glycosyl hydrolases family 18 JGI ISS
UniRef100_Q9S7G9UniRef Annotation by Michelle Graham. Best UniRef hit: Acidic chitinase n=1 Tax=Glycine max RepID=Q9S7G9_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9S7G9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Acidic chitinase n=1 Tax=Glycine max RepID=Q9S7G9_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g23136 not represented in the dataset

Glyma09g23136 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma16g28970 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g126200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g23136.1   sequence type=CDS   gene model=Glyma09g23136   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAACCCCTAACAAAGCCTCATTACTCTTATTCCCTCTCTTGTCCCTTTCCTTATTTATCAACCATTCCCATGCAGCAGGAATCGCTGTGTACTGGGGCCAAAACGGTGGAGAAGGCACCTTAGCAGAAGCTTGCAACACAGGAAACTACCAATATGTGAACATAGCCTTCTTGTCCACTTTTGGAAATGGCCAAACCCCACAACTCAACCTTGCTGGTCATTGTGACCCTAACAACAATGGTTGCACAGGGTTGAGCAGTGATATCAATACTTGCCAAGACCTTGGCATCAAAGTGTTGCTCTCTCTTGGAGGTGGTGCTGGAAGCTACTCCCTCAGCTCAGCTGATGATGCCACACAACTTGCAAACTACCTCTGGGAGAATTTCCTTGGAGGCCAAACTGGATCAGGGCCATTAGGTGATGTTATCTTGGATGGCATTGACTTTGACATTGAGTCTGGTGGGACTTCAGCTCACAGAGTAAGGGTGTACTTGTCCGCAGCCCCACAGTGCATAATCCCTGATGCACACTTGGATGCTGCCATCCAAACTGGGCTCTTTGACTATGTGTGGGTTCAGTTCTACAACAACCCTTCATGCCAATACTCCAGTGGAAACACCAACGATTTGATCAATTCATGGAACCAGTGGATCACAGTGCCAGCTTCTCTAGTCTTCATGGGGCTTCCTGCATCTGAAGCAGCTGCTCCAAGTGGTGGCTTTGTGCCTGCTGATGTGTTAACCTCTCAGATTCTTCCTGTGATTAAACAGTCTTCAAATTATGGTGGAGTCATGCTTTGGGACAGATTCAATGATGTCCAAAATGGTTATAGTAATGCTATTATTGGAAGTGTTAATTAA

>Glyma09g23136.1   sequence type=predicted peptide   gene model=Glyma09g23136   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKTPNKASLLLFPLLSLSLFINHSHAAGIAVYWGQNGGEGTLAEACNTGNYQYVNIAFLSTFGNGQTPQLNLAGHCDPNNNGCTGLSSDINTCQDLGIKVLLSLGGGAGSYSLSSADDATQLANYLWENFLGGQTGSGPLGDVILDGIDFDIESGGTSAHRVRVYLSAAPQCIIPDAHLDAAIQTGLFDYVWVQFYNNPSCQYSSGNTNDLINSWNQWITVPASLVFMGLPASEAAAPSGGFVPADVLTSQILPVIKQSSNYGGVMLWDRFNDVQNGYSNAIIGSVN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo