|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G24910 | AT | Annotation by Michelle Graham. TAIR10: cytochrome P450, family 714, subfamily A, polypeptide 1 | chr5:8567674-8570260 REVERSE LENGTH=532 | SoyBase | E_val: 4.00E-27 | ISS |
GO:0016132 | GO-bp | Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process | SoyBase | N/A | ISS |
GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
GO:0005506 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: iron ion binding | SoyBase | N/A | ISS |
GO:0009055 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron carrier activity | SoyBase | N/A | ISS |
GO:0016705 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | SoyBase | N/A | ISS |
GO:0019825 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxygen binding | SoyBase | N/A | ISS |
GO:0020037 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: heme binding | SoyBase | N/A | ISS |
UniRef100_G7J9R2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome P450 n=1 Tax=Medicago truncatula RepID=G7J9R2_MEDTR | SoyBase | E_val: 4.00E-31 | ISS |
UniRef100_I1MAF3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MAF3_SOYBN | SoyBase | E_val: 4.00E-64 | ISS |
Glyma09g22045 not represented in the dataset |
Glyma09g22045 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.09g123200 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g22045.1 sequence type=CDS gene model=Glyma09g22045 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAGGAGTTTTTTCTAGCAATGAAACTGATTCTTTCTGTGTATGGTAATTTGTGGCATGAGTCTCAAAGGGTGAGGAAGAGGCTACAAATGCAAGGTATAAAAGGGCCTCCACCCTCTTTTCTACATGGGAATCTGCCTGATATGCAAAGAATTCAATCTCAGGCCAAAGCTGCTTCCACTTGCAACTCCAACCATTCTGATCAGTTTCTAGCACATGACTACACTACAACCCTCTTCCCCTATTTTGAACACTGGAGGAAACAATATGGTACCCTTCTCTTACTTTTGATCTATTAA
>Glyma09g22045.1 sequence type=predicted peptide gene model=Glyma09g22045 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MEEFFLAMKLILSVYGNLWHESQRVRKRLQMQGIKGPPPSFLHGNLPDMQRIQSQAKAASTCNSNHSDQFLAHDYTTTLFPYFEHWRKQYGTLLLLLIY*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||