SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G43810 | AT | Annotation by Michelle Graham. TAIR10: Stabilizer of iron transporter SufD / Polynucleotidyl transferase | chr5:17611939-17616562 FORWARD LENGTH=988 | SoyBase | E_val: 3.00E-25 | ISS |
| GO:0006346 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing | SoyBase | N/A | ISS |
| GO:0007267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell-cell signaling | SoyBase | N/A | ISS |
| GO:0009616 | GO-bp | Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing | SoyBase | N/A | ISS |
| GO:0009855 | GO-bp | Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry | SoyBase | N/A | ISS |
| GO:0009887 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organ morphogenesis | SoyBase | N/A | ISS |
| GO:0009944 | GO-bp | Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis | SoyBase | N/A | ISS |
| GO:0010014 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem initiation | SoyBase | N/A | ISS |
| GO:0010050 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative phase change | SoyBase | N/A | ISS |
| GO:0010051 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation | SoyBase | N/A | ISS |
| GO:0010072 | GO-bp | Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification | SoyBase | N/A | ISS |
| GO:0010073 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem maintenance | SoyBase | N/A | ISS |
| GO:0010267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference | SoyBase | N/A | ISS |
| GO:0010586 | GO-bp | Annotation by Michelle Graham. GO Biological Process: miRNA metabolic process | SoyBase | N/A | ISS |
| GO:0016246 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA interference | SoyBase | N/A | ISS |
| GO:0035019 | GO-bp | Annotation by Michelle Graham. GO Biological Process: somatic stem cell maintenance | SoyBase | N/A | ISS |
| GO:0035196 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA | SoyBase | N/A | ISS |
| GO:0048439 | GO-bp | Annotation by Michelle Graham. GO Biological Process: flower morphogenesis | SoyBase | N/A | ISS |
| GO:0048519 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
| GO:0003743 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity | SoyBase | N/A | ISS |
| GO:0035198 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: miRNA binding | SoyBase | N/A | ISS |
| PTHR22891 | Panther | EUKARYOTIC TRANSLATION INITIATION FACTOR 2C | JGI | ISS | |
| UniRef100_B9STN2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 2c, putative n=1 Tax=Ricinus communis RepID=B9STN2_RICCO | SoyBase | E_val: 4.00E-30 | ISS |
| UniRef100_UPI000233A70E | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233A70E related cluster n=1 Tax=unknown RepID=UPI000233A70E | SoyBase | E_val: 3.00E-36 | ISS |
|
Glyma09g21860 not represented in the dataset |
Glyma09g21860 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g122100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g21860.1 sequence type=CDS gene model=Glyma09g21860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTGACACATGGTCTGTCATGTAGAGTTGGGCTCTGCCTACGAGATCGTTTATGGAGACACTATTCTTTGAGTTTGTCAAAATCATGTAAGATAGTTGGGGGTCAAAGATATACAAAAGGGCTTAACGAAAAGCAGATAACTTCTCTGCTAAAGGTCTCATGCCAGAGACCACGTGAGCAAGAGACAAATATTCTCCAGACAATTCACGAAACTGATTATGAGTATAATCCCTATGCAAAGGAGTTTGGGATTAGCATTGATAGCAAGCTTGTATCAGTTAAGGCTCGGGTGTATACATTTTTTATACCAGTTTTCTCATCGAGTATGTTCATGATTCATGTAATTGGAGTTAAATTAATATTGTGTGGACTTACATTGCGTGGACAGTGGACTTTCACCATATCACGTGTTTGCACAATTGCACTAACTTGA
>Glyma09g21860.1 sequence type=predicted peptide gene model=Glyma09g21860 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVTHGLSCRVGLCLRDRLWRHYSLSLSKSCKIVGGQRYTKGLNEKQITSLLKVSCQRPREQETNILQTIHETDYEYNPYAKEFGISIDSKLVSVKARVYTFFIPVFSSSMFMIHVIGVKLILCGLTLRGQWTFTISRVCTIALT*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
