SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g21860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g21860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g21860

Feature Type:gene_model
Chromosome:Gm09
Start:26849984
stop:26851072
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G43810AT Annotation by Michelle Graham. TAIR10: Stabilizer of iron transporter SufD / Polynucleotidyl transferase | chr5:17611939-17616562 FORWARD LENGTH=988 SoyBaseE_val: 3.00E-25ISS
GO:0006346GO-bp Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing SoyBaseN/AISS
GO:0007267GO-bp Annotation by Michelle Graham. GO Biological Process: cell-cell signaling SoyBaseN/AISS
GO:0009616GO-bp Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0009944GO-bp Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010050GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative phase change SoyBaseN/AISS
GO:0010051GO-bp Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation SoyBaseN/AISS
GO:0010072GO-bp Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification SoyBaseN/AISS
GO:0010073GO-bp Annotation by Michelle Graham. GO Biological Process: meristem maintenance SoyBaseN/AISS
GO:0010267GO-bp Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference SoyBaseN/AISS
GO:0010586GO-bp Annotation by Michelle Graham. GO Biological Process: miRNA metabolic process SoyBaseN/AISS
GO:0016246GO-bp Annotation by Michelle Graham. GO Biological Process: RNA interference SoyBaseN/AISS
GO:0035019GO-bp Annotation by Michelle Graham. GO Biological Process: somatic stem cell maintenance SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0048439GO-bp Annotation by Michelle Graham. GO Biological Process: flower morphogenesis SoyBaseN/AISS
GO:0048519GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003743GO-mf Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity SoyBaseN/AISS
GO:0035198GO-mf Annotation by Michelle Graham. GO Molecular Function: miRNA binding SoyBaseN/AISS
PTHR22891Panther EUKARYOTIC TRANSLATION INITIATION FACTOR 2C JGI ISS
UniRef100_B9STN2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 2c, putative n=1 Tax=Ricinus communis RepID=B9STN2_RICCO SoyBaseE_val: 4.00E-30ISS
UniRef100_UPI000233A70EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A70E related cluster n=1 Tax=unknown RepID=UPI000233A70E SoyBaseE_val: 3.00E-36ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g21860 not represented in the dataset

Glyma09g21860 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g122100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g21860.1   sequence type=CDS   gene model=Glyma09g21860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGACACATGGTCTGTCATGTAGAGTTGGGCTCTGCCTACGAGATCGTTTATGGAGACACTATTCTTTGAGTTTGTCAAAATCATGTAAGATAGTTGGGGGTCAAAGATATACAAAAGGGCTTAACGAAAAGCAGATAACTTCTCTGCTAAAGGTCTCATGCCAGAGACCACGTGAGCAAGAGACAAATATTCTCCAGACAATTCACGAAACTGATTATGAGTATAATCCCTATGCAAAGGAGTTTGGGATTAGCATTGATAGCAAGCTTGTATCAGTTAAGGCTCGGGTGTATACATTTTTTATACCAGTTTTCTCATCGAGTATGTTCATGATTCATGTAATTGGAGTTAAATTAATATTGTGTGGACTTACATTGCGTGGACAGTGGACTTTCACCATATCACGTGTTTGCACAATTGCACTAACTTGA

>Glyma09g21860.1   sequence type=predicted peptide   gene model=Glyma09g21860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVTHGLSCRVGLCLRDRLWRHYSLSLSKSCKIVGGQRYTKGLNEKQITSLLKVSCQRPREQETNILQTIHETDYEYNPYAKEFGISIDSKLVSVKARVYTFFIPVFSSSMFMIHVIGVKLILCGLTLRGQWTFTISRVCTIALT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo