SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g21660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g21660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g21660

Feature Type:gene_model
Chromosome:Gm09
Start:26705280
stop:26706958
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G40270AT Annotation by Michelle Graham. TAIR10: Protein kinase family protein | chr2:16822136-16824327 REVERSE LENGTH=489 SoyBaseE_val: 4.00E-35ISS
GO:0002237GO-bp Annotation by Michelle Graham. GO Biological Process: response to molecule of bacterial origin SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009625GO-bp Annotation by Michelle Graham. GO Biological Process: response to insect SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF458Panther SUBFAMILY NOT NAMED JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
PF07714PFAM Protein tyrosine kinase JGI ISS
UniRef100_I1J5S7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1J5S7_SOYBN SoyBaseE_val: 3.00E-80ISS
UniRef100_Q84U00UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ser-thr protein kinase (Fragment) n=1 Tax=Gossypium hirsutum RepID=Q84U00_GOSHI SoyBaseE_val: 2.00E-48ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g21660 not represented in the dataset

Glyma09g21660 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g21660.1   sequence type=CDS   gene model=Glyma09g21660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATAGTTCATAGGCATCTTGAAAATTGTTTGCAATATGCACCGGCATTTAATGTTTTTTCAGTTTTGACTTCATTCTTGCATTATGCTGCAGTTAGAGAAGGCGAAGAACTAAATTGGACAATGAGAATGAGGATAGCTATGGGGATAGCCTACTGCCTAGAGTATATGCATGAGCTGAAACCACCCATTGCCCATAGAAACCTGCAATCTTCCTTTATATACCTTACTGAAGATTATGCTGCTAAAATATCAGATCTTAGTTTATGGAATGACATAGACAATGTTTACAGCTTTGGAATAGTATTGTTTGTGTTGATTACAGGGAGAATTCCGCTTGCTGGGAACAATGAACTTCTGGCAGATTGGGCAGCAGAATATGTAAGGTGGGGGAAATCCTTAAGACATGTTGTGGATCCAAGGCAGAAGTCTTTGCAGGAAGAAGAGATTGAGGAATGGTCTGAAGTGATAAGAAACTGTGTACAACCAGATCCGGAGAGAAGGCAAGCATCACCACTTTGGTGA

>Glyma09g21660.1   sequence type=predicted peptide   gene model=Glyma09g21660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IVHRHLENCLQYAPAFNVFSVLTSFLHYAAVREGEELNWTMRMRIAMGIAYCLEYMHELKPPIAHRNLQSSFIYLTEDYAAKISDLSLWNDIDNVYSFGIVLFVLITGRIPLAGNNELLADWAAEYVRWGKSLRHVVDPRQKSLQEEEIEEWSEVIRNCVQPDPERRQASPLW*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo