|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G57000 | AT | Annotation by Michelle Graham. TAIR10: nucleolar essential protein-related | chr3:21092610-21094109 FORWARD LENGTH=298 | SoyBase | E_val: 7.00E-36 | ISS |
GO:0000085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle | SoyBase | N/A | ISS |
GO:0006626 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion | SoyBase | N/A | ISS |
GO:0009640 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photomorphogenesis | SoyBase | N/A | ISS |
GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
GO:0034968 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone lysine methylation | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0008168 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity | SoyBase | N/A | ISS |
PTHR12636 | Panther | NEP1 | JGI | ISS | |
PTHR12636:SF2 | Panther | UNCHARACTERIZED | JGI | ISS | |
PF03587 | PFAM | EMG1/NEP1 methyltransferase | JGI | ISS | |
UniRef100_B9SZX7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Nucleolar essential protein, putative n=1 Tax=Ricinus communis RepID=B9SZX7_RICCO | SoyBase | E_val: 1.00E-34 | ISS |
UniRef100_UPI0002338155 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002338155 related cluster n=1 Tax=unknown RepID=UPI0002338155 | SoyBase | E_val: 9.00E-81 | ISS |
Glyma09g21291 not represented in the dataset |
Glyma09g21291 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.09g120100 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g21291.1 sequence type=CDS gene model=Glyma09g21291 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTAGGGGCAATATACGTTAAAATGGATCAACGAGGAGTGTTTGAAGTCAAACCACATGTTCGTATACCAAGAACGTGTAATCGATTCTGTGGTGTCATAATTCTTCTTCGTGTTGTTGAGGAACCTATAACACGCCATTTGCCTGTCAACTCTCACATAGTAGGTCTCTCTTATACTTCAGAAAAGTTGGTTGACATAGAGGAATATGTCTCAGTTTGGAGCAATGATTTGAGTCCTGTTTTTGTGGTAGGCACAATGGTGAATGGGAAAGTAAAAGGGGACTATATGCATGATTATATTTCAATTTCTGAATATCCACTTGCTGCTAAATACTGCCTAGGAATGATATGTGAAGCTTTGTAG
>Glyma09g21291.1 sequence type=predicted peptide gene model=Glyma09g21291 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVGAIYVKMDQRGVFEVKPHVRIPRTCNRFCGVIILLRVVEEPITRHLPVNSHIVGLSYTSEKLVDIEEYVSVWSNDLSPVFVVGTMVNGKVKGDYMHDYISISEYPLAAKYCLGMICEAL*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||