SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g18890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g18890): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g18890

Feature Type:gene_model
Chromosome:Gm09
Start:23452240
stop:23452452
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g18890
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G60460AT Annotation by Michelle Graham. TAIR10: Preprotein translocase Sec, Sec61-beta subunit protein | chr5:24317590-24317919 REVERSE LENGTH=109 SoyBaseE_val: 1.00E-21ISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0008565GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transporter activity SoyBaseN/AISS
PTHR13509Panther SEC61BETA-PROV PROTEIN JGI ISS
PF03911PFAM Sec61beta family JGI ISS
UniRef100_B9SK56UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein transport protein Sec61 subunit beta, putative n=1 Tax=Ricinus communis RepID=B9SK56_RICCO SoyBaseE_val: 3.00E-24ISS
UniRef100_I1L2Q0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1L2Q0_SOYBN SoyBaseE_val: 5.00E-41ISS

Expression Patterns of Glyma09g18890
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g18890 not represented in the dataset
Glyma09g18890 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g18890 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g114200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g18890
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g18890
>Glyma09g18890.1   sequence type=CDS   gene model=Glyma09g18890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACCACCGCCGTCTCGGCAGCAGAAACAGCTCTACCAGCACCGTCATTGGAGGCGGCAACAACAACATCCTGAGGTTCTACACGGACGATGCCCCGGGGCTGAAGATTTCGCCGACGGTGGTGCTCGTGATGAGCTTCTGCTTCATCGGCTTCACCGCGCTCCACGTGTTCGGCAAACTCTACCGCTCCAAATCTGGTGGCGCCGTTTGA
Predicted protein sequences of Glyma09g18890
>Glyma09g18890.1   sequence type=predicted peptide   gene model=Glyma09g18890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHHRRLGSRNSSTSTVIGGGNNNILRFYTDDAPGLKISPTVVLVMSFCFIGFTALHVFGKLYRSKSGGAV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo