Glyma09g17646 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g17646): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g17646): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g17646

Feature Type:	gene_model
Chromosome:	Gm09
Start:	22054940
stop:	22057331
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g17646

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G10900	AT	Annotation by Michelle Graham. TAIR10: Phosphatidylinositol-4-phosphate 5-kinase family protein \| chr1:3632396-3636416 REVERSE LENGTH=754	SoyBase	E_val: 1.00E-28	ISS
GO:0046488	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol metabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016307	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol phosphate kinase activity	SoyBase	N/A	ISS
GO:0016308	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 1-phosphatidylinositol-4-phosphate 5-kinase activity	SoyBase	N/A	ISS
PTHR23086	Panther	PHOSPHATIDYLINOSITOL-4-PHOSPHATE 5-KINASE	JGI		ISS
PTHR23086:SF6	Panther	PHOSPHATIDYLINOSITOL-4-PHOSPHATE 5-KINASE	JGI		ISS
PF01504	PFAM	Phosphatidylinositol-4-phosphate 5-Kinase	JGI		ISS
UniRef100_G7L8W6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Phosphatidylinositol-4-phosphate 5-kinase n=1 Tax=Medicago truncatula RepID=G7L8W6_MEDTR	SoyBase	E_val: 4.00E-35	ISS
UniRef100_I1MDN9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MDN9_SOYBN	SoyBase	E_val: 6.00E-44	ISS

Expression Patterns of Glyma09g17646

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g17646 not represented in the dataset	Glyma09g17646 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g17646 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g113600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g17646

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g17646

Limit To All Plant Sequences

>Glyma09g17646.1   sequence type=CDS   gene model=Glyma09g17646   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAGCTCAAGCTACTCGGAAGGTTGAGGAGGAGGTGGAGGCAAAAGAAGTAGAGCTTTTTGAGGTATATGATGTTGTCCTCTACATGGGCGTAATTGATATATTGCAGAACTATAATCTGAGAAAGAAAATTGAGCATGCATACAAATCACTGCAATTTGACCCTAAGACAATATTAGTAGTTGAACCCAAGATGTATGATGAACGTTTCATCAAATTTTTAGAGGAAAAAGTTTTCCCCGAGACCCCCTGA

Predicted protein sequences of Glyma09g17646

Limit To All Plant Sequences

>Glyma09g17646.1   sequence type=predicted peptide   gene model=Glyma09g17646   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPAQATRKVEEEVEAKEVELFEVYDVVLYMGVIDILQNYNLRKKIEHAYKSLQFDPKTILVVEPKMYDERFIKFLEEKVFPETP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain