|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G10360 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein S6e | chr5:3258734-3260142 REVERSE LENGTH=197 | SoyBase | E_val: 5.00E-23 | ISS |
GO:0006364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: rRNA processing | SoyBase | N/A | ISS |
GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
GO:0040007 | GO-bp | Annotation by Michelle Graham. GO Biological Process: growth | SoyBase | N/A | ISS |
GO:0042274 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ribosomal small subunit biogenesis | SoyBase | N/A | ISS |
GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
GO:0022627 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit | SoyBase | N/A | ISS |
GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
PTHR11502 | Panther | 40S RIBOSOMAL PROTEIN S6 | JGI | ISS | |
UniRef100_I1MM57 | UniRef | Annotation by Michelle Graham. Best UniRef hit: 40S ribosomal protein S6 (Fragment) n=2 Tax=Glycine max RepID=I1MM57_SOYBN | SoyBase | E_val: 4.00E-22 | ISS |
UniRef100_I1MM57 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S6 (Fragment) n=2 Tax=Glycine max RepID=I1MM57_SOYBN | SoyBase | E_val: 4.00E-22 | ISS |
Glyma09g17356 not represented in the dataset |
Glyma09g17356 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g17356.1 sequence type=CDS gene model=Glyma09g17356 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATTGTGATGATTTCTAGTCTGAGTTACAGATGTTTGGTTGTAGGGAAAAAGGTGAGCAAAGCTCCTAAGATACAACGGCTGGTCACTCCCCTGACCCTCCAAAGAAATAGGGCAAGGATTGCAGATAAGAAGAAGAGAATTGCCAAAGCAAAATCAGAGGCAGCAGAGTACCAGAAACTTCTTGCCTCCAAAAAAATAAGCCTAGGTTCTTGA
>Glyma09g17356.1 sequence type=predicted peptide gene model=Glyma09g17356 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MIVMISSLSYRCLVVGKKVSKAPKIQRLVTPLTLQRNRARIADKKKRIAKAKSEAAEYQKLLASKKISLGS*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||