SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g17308): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g17308): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g17308

Feature Type:gene_model
Chromosome:Gm09
Start:21168438
stop:21169181
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g17308
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G73020AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF590 (InterPro:IPR007632). | chr1:27469714-27473181 REVERSE LENGTH=665 SoyBaseE_val: 2.00E-37ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR12308Panther UNCHARACTERIZED JGI ISS
PTHR12308:SF9Panther gb def: flj00159 protein [homo sapiens] JGI ISS
PF04547PFAM Calcium-activated chloride channel JGI ISS
UniRef100_C9WMM7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Starch branching enzyme interacting protein-1 n=1 Tax=Zea mays RepID=C9WMM7_MAIZE SoyBaseE_val: 2.00E-26ISS
UniRef100_I1KUY1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KUY1_SOYBN SoyBaseE_val: 1.00E-69ISS

Expression Patterns of Glyma09g17308
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g17308 not represented in the dataset
Glyma09g17308 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g17308 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g112900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g17308
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g17308
>Glyma09g17308.1   sequence type=CDS   gene model=Glyma09g17308   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTCAGAAGAAGGCAACAACATGTGGAGGAAGAAAAAGCTGTCACACGGTGGATGCTCTTCCCTATTATGGGGCAAAGATTGCAATCTATTTTGCTTTTCTTGGAATGTTCACACAGCGGATGCTCTTCCCTGCTGCATTTGGGCTTACTTTGCAATTGATAGATTTTGGGTCATTGAAATTAGTCGTGCTTCCTATTTTCTTCATCATGGTGATACTTTGGGCTATAATGTTTTCTCAGTTCTGGAAACGTAAAAATTCTGCACTTTTAGCCAGATGGCCTATTAGTTCTATAGTTGCAGCTGACCAAGGATACAAGATTTCAGGCAGGAAGTCTAGCTCCTGGCAACCCCCAATGGAACTCATGAAAGTATTTGAGACTGATAGAGCTAAAGAGAAGGAAATATTCTAG
Predicted protein sequences of Glyma09g17308
>Glyma09g17308.1   sequence type=predicted peptide   gene model=Glyma09g17308   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFQKKATTCGGRKSCHTVDALPYYGAKIAIYFAFLGMFTQRMLFPAAFGLTLQLIDFGSLKLVVLPIFFIMVILWAIMFSQFWKRKNSALLARWPISSIVAADQGYKISGRKSSSWQPPMELMKVFETDRAKEKEIF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo