SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g17260

Feature Type:gene_model
Chromosome:Gm09
Start:21136799
stop:21137392
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g17260
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G57950AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 9 plant structures; EXPRESSED DURING: 4 anthesis, C globular stage, petal differentiation and expansion stage; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G42180.1); Has 81 Blast hits to 81 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 81; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | c SoyBaseE_val: 7.00E-35ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1L2N3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L2N3_SOYBN SoyBaseE_val: 2.00E-144ISS

Expression Patterns of Glyma09g17260
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g17260 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g112700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g17260
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g17260
>Glyma09g17260.1   sequence type=CDS   gene model=Glyma09g17260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTTGTCCATCCTCCCATCTCAGAACCTCACACCCTCCACCCTCTTCTTCAGCCCTAAGCTCCATGAAGCTCAAGAGCCTCATCCACACCCTCATAGTCTCCCACATGTGCCGCATCATCCGTGCACTCTCCAAAGTCAAAGCCACAATCCTTGAGATTCTCAAAGGATCAAACAACCAATCCAATAACATTCACTTCCACCACAAAAAGAAGCAAAAGATGACTAAGAAAATCATCTTTGGCTCGTTCAGGCTCCACTACAACTGGTGCTCCTCAAAATCTTCTCATGTTATCCCTGTTCCCGCTCGTGTCTTTGAAGGGTTGCCAAAAGCTGGTGACATGATCCATCATCATGATGAACAATATTTGTATGAGGATTGCCATGATGATGATTCTCAGCTTGCGGGATACCTACAGTGGCTTGAAGAGAAGGTTCAAGATGATGATGATGATAAAAAGGCTTGTGGAAATGAGATGAACGAGATTGATATGTTGGCTGAAATGTTCATAGCGAATTGCCACGAGAAGTTCAAGTTGGAGAAGCAAGAGTCTGATAGAAGGTTCCATGAAATGTTGGCTAGGGGCATGTGA
Predicted protein sequences of Glyma09g17260
>Glyma09g17260.1   sequence type=predicted peptide   gene model=Glyma09g17260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPCPSSHLRTSHPPPSSSALSSMKLKSLIHTLIVSHMCRIIRALSKVKATILEILKGSNNQSNNIHFHHKKKQKMTKKIIFGSFRLHYNWCSSKSSHVIPVPARVFEGLPKAGDMIHHHDEQYLYEDCHDDDSQLAGYLQWLEEKVQDDDDDKKACGNEMNEIDMLAEMFIANCHEKFKLEKQESDRRFHEMLARGM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo