Glyma09g17100 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g17100

Feature Type:	gene_model
Chromosome:	Gm09
Start:	20826958
stop:	20829815
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g17100

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G42110	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 27 Blast hits to 27 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 25; Viruses - 0; Other Eukaryotes - 2 (source: NCBI BLink). \| chr2:17562234-17562732 REVERSE LENGTH=137	SoyBase	E_val: 1.00E-26	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR24580	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24580:SF18	Panther		JGI		ISS
UniRef100_UPI00023382FB	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023382FB related cluster n=1 Tax=unknown RepID=UPI00023382FB	SoyBase	E_val: 2.00E-72	ISS

Expression Patterns of Glyma09g17100

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g17100 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g111500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g17100

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g17100

Limit To All Plant Sequences

>Glyma09g17100.2   sequence type=CDS   gene model=Glyma09g17100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATATTGCCACCACAGGGGTTCAGCATGTGACCAAGAAAAGTTCCGATGAACTTCTGAGGAAGTTTGCTGAAGTGGGTGATTCTAACAATGCCCCAAAGAAGAAGAAAACAAAGAGGACGGCGGAAGACGGTAGCGGCACTGCCGTGGTGGAACGGCGGTCGCTTCTTCTGAGGGCTCACCTCAGGGCAAGGGATCTCACTCATTTCAGAACCAAGTCTCTATTGGGAACAATTGAGAAGACATGGCGTAGAACCATAGAAGGGGCTTCTAGAGCTTTCATTGAGAGGCACTATCATCGTCATAAGCGTTTGATCAATGATATAGTTTAG

Predicted protein sequences of Glyma09g17100

Limit To All Plant Sequences

>Glyma09g17100.2   sequence type=predicted peptide   gene model=Glyma09g17100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDIATTGVQHVTKKSSDELLRKFAEVGDSNNAPKKKKTKRTAEDGSGTAVVERRSLLLRAHLRARDLTHFRTKSLLGTIEKTWRRTIEGASRAFIERHYHRHKRLINDIV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain