Glyma09g16960 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g16960

Feature Type:	gene_model
Chromosome:	Gm09
Start:	20635684
stop:	20636353
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g16960

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G47550	AT	Annotation by Michelle Graham. TAIR10: Cystatin/monellin superfamily protein \| chr5:19286596-19286964 REVERSE LENGTH=122	SoyBase	E_val: 1.00E-26	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0004869	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cysteine-type endopeptidase inhibitor activity	SoyBase	N/A	ISS
PTHR11413	Panther	CYSTATIN FAMILY MEMBER	JGI		ISS
PTHR11413:SF28	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00031	PFAM	Cystatin domain	JGI		ISS
UniRef100_G7JLQ2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cysteine proteinase inhibitor n=1 Tax=Medicago truncatula RepID=G7JLQ2_MEDTR	SoyBase	E_val: 6.00E-38	ISS
UniRef100_I1L2L4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1L2L4_SOYBN	SoyBase	E_val: 6.00E-70	ISS

Expression Patterns of Glyma09g16960

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g16960 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g110600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g16960

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g16960

Limit To All Plant Sequences

>Glyma09g16960.1   sequence type=CDS   gene model=Glyma09g16960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGACACCACTGTCTCCTTCTCCTCTCCCTCGTCTTGGTCTCCTACGCTGCCCGACGGTCGGAATCTGCGCTGGGCGGCTGGAGCCCCATCAAGGACGTGAACGACAGCCACGTGGCGGAGATCGCGAACTACGCGGTGAGCGAGTACGACAAGCGTTCTGGGGCAAAGCTGACGCTGGTCAAGGTATCAAAGGGCGAGACTCAGGTCGTGGCCGGCACCAACTACCGCCTGGTCCTCAAGGTCAAGAATGGATCCACCACGGCCAGTTACCAAGCCACCGTGCTGGAGAAGCCTTGGCTCCATTTCAGGAATCCCACTTCCTTCAAACCCCTTCGTTCTTAG

Predicted protein sequences of Glyma09g16960

Limit To All Plant Sequences

>Glyma09g16960.1   sequence type=predicted peptide   gene model=Glyma09g16960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRHHCLLLLSLVLVSYAARRSESALGGWSPIKDVNDSHVAEIANYAVSEYDKRSGAKLTLVKVSKGETQVVAGTNYRLVLKVKNGSTTASYQATVLEKPWLHFRNPTSFKPLRS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain