Report for Sequence Feature Glyma09g16960
Feature Type: gene_model
Chromosome: Gm09
Start: 20635684
stop: 20636353
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma09g16960
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G47550 AT
Annotation by Michelle Graham. TAIR10: Cystatin/monellin superfamily protein | chr5:19286596-19286964 REVERSE LENGTH=122
SoyBase E_val: 1.00E-26 ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005618 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cell wall
SoyBase N/A ISS
GO:0004869 GO-mf
Annotation by Michelle Graham. GO Molecular Function: cysteine-type endopeptidase inhibitor activity
SoyBase N/A ISS
PTHR11413 Panther
CYSTATIN FAMILY MEMBER
JGI ISS
PTHR11413:SF28 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00031 PFAM
Cystatin domain
JGI ISS
UniRef100_G7JLQ2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Cysteine proteinase inhibitor n=1 Tax=Medicago truncatula RepID=G7JLQ2_MEDTR
SoyBase E_val: 6.00E-38 ISS
UniRef100_I1L2L4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1L2L4_SOYBN
SoyBase E_val: 6.00E-70 ISS
Expression Patterns of Glyma09g16960
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma09g16960 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.09g110600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma09g16960
Coding sequences of Glyma09g16960
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma09g16960.1 sequence type=CDS gene model=Glyma09g16960 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGACACCACTGTCTCCTTCTCCTCTCCCTCGTCTTGGTCTCCTACGCTGCCCGACGGTCGGAATCTGCGCTGGGCGGCTGGAGCCCCATCAAGGACGTGAACGACAGCCACGTGGCGGAGATCGCGAACTACGCGGTGAGCGAGTACGACAAGCGTTCTGGGGCAAAGCTGACGCTGGTCAAGGTATCAAAGGGCGAGACTCAGGTCGTGGCCGGCACCAACTACCGCCTGGTCCTCAAGGTCAAGAATGGATCCACCACGGCCAGTTACCAAGCCACCGTGCTGGAGAAGCCTTGGCTCCATTTCAGGAATCCCACTTCCTTCAAACCCCTTCGTTCTTAG
Predicted protein sequences of Glyma09g16960
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma09g16960.1 sequence type=predicted peptide gene model=Glyma09g16960 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MRHHCLLLLSLVLVSYAARRSESALGGWSPIKDVNDSHVAEIANYAVSEYDKRSGAKLTLVKVSKGETQVVAGTNYRLVLKVKNGSTTASYQATVLEKPWLHFRNPTSFKPLRS*