SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g16673

Feature Type:gene_model
Chromosome:Gm09
Start:20042681
stop:20045129
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g16673
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G12050AT Annotation by Michelle Graham. TAIR10: Aha1 domain-containing protein | chr3:3839289-3841303 FORWARD LENGTH=321 SoyBaseE_val: 8.00E-94ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0001671GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activator activity SoyBaseN/AISS
GO:0051087GO-mf Annotation by Michelle Graham. GO Molecular Function: chaperone binding SoyBaseN/AISS
PTHR13009Panther HEAT SHOCK PROTEIN 90 (HSP90) CO-CHAPERONE AHA-1 JGI ISS
PF08327PFAM Activator of Hsp90 ATPase homolog 1-like protein JGI ISS
UniRef100_D7KZN7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aha1 domain-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KZN7_ARALL SoyBaseE_val: 2.00E-91ISS
UniRef100_I1L2K7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L2K7_SOYBN SoyBaseE_val: 4.00E-143ISS

Expression Patterns of Glyma09g16673
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g16673 not represented in the dataset
Glyma09g16673 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma09g16673
ParalogEvidenceComments
Glyma02g28830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma09g16673 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g109200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g16673
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g16673
>Glyma09g16673.1   sequence type=CDS   gene model=Glyma09g16673   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGAAGAAGGGGAGGGTGGTGGTTTTGGAGAAGGTTAGGGTTTGGGTGGAGAGCATGGCGAAGGGTGGGCCCGTGAAGGACGAGCTCGAAGCGAAGAAGGTTGCGGTACCTCACAACAAAAACAACACTAGTAGTAGTAATGGTGATAACAATGATTTGAAGAAGGAAGAGGTTAACAAGAGTGAGGGGAAGAAGGGGTTTAAGTTGATTAGTTTGACTGAGAAGTTTAATTGTAGGGCGAGGGATTTGTTTGAGATTCTGATGGATGAGAATAGGTGGAGGGGTTTTACGCAGAGCAATGCGAGGATTAGTAAGGAGGTTGGAGGAGAGTTTAGTATTTTCGACGGGTCGGTGACGGGGAAGAATTTGGAGTTGGAGGAAGGGATGTTGATTGTGCAGAGATGGAGGTTTGGGAGCTGGCCTGATGGGATTGAATCCATGGTGAGGATTATGTTTGAGGAGCCTGAAGATGGAGTCACTGTTGTTAAGCTCACACATAGTGATGTCCCTGAAGAAGACAGATATGGAAATGCAACTGTGGTGGAGAACACAGAGAGGGGTTGGCGGGATCTCATTTTCCAAAGGATACGAACTGCGTTTGGTTTTGGAATTTGA
Predicted protein sequences of Glyma09g16673
>Glyma09g16673.1   sequence type=predicted peptide   gene model=Glyma09g16673   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKKGRVVVLEKVRVWVESMAKGGPVKDELEAKKVAVPHNKNNTSSSNGDNNDLKKEEVNKSEGKKGFKLISLTEKFNCRARDLFEILMDENRWRGFTQSNARISKEVGGEFSIFDGSVTGKNLELEEGMLIVQRWRFGSWPDGIESMVRIMFEEPEDGVTVVKLTHSDVPEEDRYGNATVVENTERGWRDLIFQRIRTAFGFGI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo