Glyma09g16656 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g16656): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g16656): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g16656

Feature Type:	gene_model
Chromosome:	Gm09
Start:	20036960
stop:	20037709
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g16656

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G12050	AT	Annotation by Michelle Graham. TAIR10: Aha1 domain-containing protein \| chr3:3839289-3841303 FORWARD LENGTH=360	SoyBase	E_val: 1.00E-55	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0034976	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0001671	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activator activity	SoyBase	N/A	ISS
GO:0051087	GO-mf	Annotation by Michelle Graham. GO Molecular Function: chaperone binding	SoyBase	N/A	ISS
PTHR13009	Panther	HEAT SHOCK PROTEIN 90 (HSP90) CO-CHAPERONE AHA-1	JGI		ISS
PF09229	PFAM	Activator of Hsp90 ATPase, N-terminal	JGI		ISS
UniRef100_D7KZN7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Aha1 domain-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KZN7_ARALL	SoyBase	E_val: 3.00E-53	ISS
UniRef100_UPI000233818B	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233818B related cluster n=1 Tax=unknown RepID=UPI000233818B	SoyBase	E_val: 2.00E-81	ISS

Expression Patterns of Glyma09g16656

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g16656 not represented in the dataset	Glyma09g16656 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g16656 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma09g16656

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g16656

Limit To All Plant Sequences

>Glyma09g16656.1   sequence type=CDS   gene model=Glyma09g16656   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAAGTTTGGCGAGGGCGACAAGCGGTGGATCGTGGCGGAGCGTCCCGACGGCACTAACGTGCACAACTGGCACTGGGCGGAGACCAACTGCCTCGAGTGGTCCAGAACCTTCTTCAAGAACAATTTCAGTAACGTCGCCGTCGGTGGCGGCGACGGCGATGCCACCATCACGATCAAGAAGGTGGAGAAGCTCGATGGCGAGGCCTACGTGAACGTCCGCAAGGGGAAGGTGATCCCCGGGTACGAGATCAGCGTGAGGCTCGCGTGGGAGGGCGAGGCGCGGGACGCCAACGGGAAGGTTCTGCAGAGAGTCGACGGCGCCGTCGAGATCCCCTACATCTCCGCGTGTCACTTATCGTGA

Predicted protein sequences of Glyma09g16656

Limit To All Plant Sequences

>Glyma09g16656.1   sequence type=predicted peptide   gene model=Glyma09g16656   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKFGEGDKRWIVAERPDGTNVHNWHWAETNCLEWSRTFFKNNFSNVAVGGGDGDATITIKKVEKLDGEAYVNVRKGKVIPGYEISVRLAWEGEARDANGKVLQRVDGAVEIPYISACHLS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain