|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G12050 | AT | Annotation by Michelle Graham. TAIR10: Aha1 domain-containing protein | chr3:3839289-3841303 FORWARD LENGTH=360 | SoyBase | E_val: 1.00E-55 | ISS |
| GO:0006457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein folding | SoyBase | N/A | ISS |
| GO:0009408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to heat | SoyBase | N/A | ISS |
| GO:0009644 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to high light intensity | SoyBase | N/A | ISS |
| GO:0034976 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress | SoyBase | N/A | ISS |
| GO:0042542 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0001671 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATPase activator activity | SoyBase | N/A | ISS |
| GO:0051087 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: chaperone binding | SoyBase | N/A | ISS |
| PTHR13009 | Panther | HEAT SHOCK PROTEIN 90 (HSP90) CO-CHAPERONE AHA-1 | JGI | ISS | |
| PF09229 | PFAM | Activator of Hsp90 ATPase, N-terminal | JGI | ISS | |
| UniRef100_D7KZN7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Aha1 domain-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KZN7_ARALL | SoyBase | E_val: 3.00E-53 | ISS |
| UniRef100_UPI000233818B | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233818B related cluster n=1 Tax=unknown RepID=UPI000233818B | SoyBase | E_val: 2.00E-81 | ISS |
|
Glyma09g16656 not represented in the dataset |
Glyma09g16656 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g16656.1 sequence type=CDS gene model=Glyma09g16656 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCGAAGTTTGGCGAGGGCGACAAGCGGTGGATCGTGGCGGAGCGTCCCGACGGCACTAACGTGCACAACTGGCACTGGGCGGAGACCAACTGCCTCGAGTGGTCCAGAACCTTCTTCAAGAACAATTTCAGTAACGTCGCCGTCGGTGGCGGCGACGGCGATGCCACCATCACGATCAAGAAGGTGGAGAAGCTCGATGGCGAGGCCTACGTGAACGTCCGCAAGGGGAAGGTGATCCCCGGGTACGAGATCAGCGTGAGGCTCGCGTGGGAGGGCGAGGCGCGGGACGCCAACGGGAAGGTTCTGCAGAGAGTCGACGGCGCCGTCGAGATCCCCTACATCTCCGCGTGTCACTTATCGTGA
>Glyma09g16656.1 sequence type=predicted peptide gene model=Glyma09g16656 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAKFGEGDKRWIVAERPDGTNVHNWHWAETNCLEWSRTFFKNNFSNVAVGGGDGDATITIKKVEKLDGEAYVNVRKGKVIPGYEISVRLAWEGEARDANGKVLQRVDGAVEIPYISACHLS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||