|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G43080 | AT | Annotation by Michelle Graham. TAIR10: Cyclin A3;1 | chr5:17293227-17294789 FORWARD LENGTH=355 | SoyBase | E_val: 1.00E-47 | ISS |
| GO:0000079 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cyclin-dependent protein kinase activity | SoyBase | N/A | ISS |
| GO:0000724 | GO-bp | Annotation by Michelle Graham. GO Biological Process: double-strand break repair via homologous recombination | SoyBase | N/A | ISS |
| GO:0010389 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of G2/M transition of mitotic cell cycle | SoyBase | N/A | ISS |
| GO:0051726 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| GO:0016538 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: cyclin-dependent protein kinase regulator activity | SoyBase | N/A | ISS |
| GO:0019901 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein kinase binding | SoyBase | N/A | ISS |
| PTHR10177 | Panther | CYCLINS | JGI | ISS | |
| PTHR10177:SF49 | Panther | G2/MITOTIC-SPECIFIC CYCLIN | JGI | ISS | |
| PF00134 | PFAM | Cyclin, N-terminal domain | JGI | ISS | |
| UniRef100_I1L2K2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L2K2_SOYBN | SoyBase | E_val: 2.00E-84 | ISS |
| UniRef100_Q39877 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Mitotic cyclin a1-type n=1 Tax=Glycine max RepID=Q39877_SOYBN | SoyBase | E_val: 1.00E-53 | ISS |
|
Glyma09g16566 not represented in the dataset |
Glyma09g16566 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g108600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g16566.1 sequence type=CDS gene model=Glyma09g16566 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high AGAAAGAGAAGACCAATGTTTAACTACATGGATAGAGTTCAACACATGGTTACTGTAAACATGAGAGGAATCTTTATGGATTGGTTAGTGGAAGTTGTTGTAGAGTACAAGCTTCTCTCAAAAACCCTTAATCTCTCTATGTCATACATTCATAGGTTTTTGTCTGTTAATCCTATGAGCAAATCGAGGCTTCAGTTGCTTGATGTTTCTTCCATGCTCATTGCTTCGAAGTATGAGGAAGTTAATCCACCCGGTGTTGACAAATTCTATAGCATCACTAATAACACTTATGAAAAGGCAGAGATGGAAGCTAAAATACTTGCGTCCCTAAATTTTGAAATTGGAAATCCTACTGCAATCACTTTTCTAAGGTATATATTGCAAATGTGA
>Glyma09g16566.1 sequence type=predicted peptide gene model=Glyma09g16566 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high RKRRPMFNYMDRVQHMVTVNMRGIFMDWLVEVVVEYKLLSKTLNLSMSYIHRFLSVNPMSKSRLQLLDVSSMLIASKYEEVNPPGVDKFYSITNNTYEKAEMEAKILASLNFEIGNPTAITFLRYILQM*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||