SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g15895): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g15895): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g15895

Feature Type:gene_model
Chromosome:Gm09
Start:18884614
stop:18885772
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma09g15895
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G11980AT Annotation by Michelle Graham. TAIR10: Jojoba acyl CoA reductase-related male sterility protein | chr3:3814484-3816927 FORWARD LENGTH=616 SoyBaseE_val: 2.00E-90ISS
GO:0009556GO-bp Annotation by Michelle Graham. GO Biological Process: microsporogenesis SoyBaseN/AISS
GO:0010584GO-bp Annotation by Michelle Graham. GO Biological Process: pollen exine formation SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0016620GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor SoyBaseN/AISS
GO:0016628GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor SoyBaseN/AISS
GO:0080019GO-mf Annotation by Michelle Graham. GO Molecular Function: fatty-acyl-CoA reductase (alcohol-forming) activity SoyBaseN/AISS
PTHR11011Panther MALE STERILITY PROTEIN 2-RELATED JGI ISS
PTHR11011:SF1Panther MALE STERILITY PROTEIN 2 JGI ISS
PF03015PFAM Male sterility protein JGI ISS
UniRef100_Q53E54UniRef Annotation by Michelle Graham. Most informative UniRef hit: Male sterility protein 2-1 mutant n=1 Tax=Brassica napus RepID=Q53E54_BRANA SoyBaseE_val: 4.00E-88ISS
UniRef100_UPI000233C1A8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C1A8 related cluster n=1 Tax=unknown RepID=UPI000233C1A8 SoyBaseE_val: 6.00E-132ISS

Expression Patterns of Glyma09g15895
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g15895 not represented in the dataset
Glyma09g15895 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g15895 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g104800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma09g15895
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma09g15895
>Glyma09g15895.1   sequence type=CDS   gene model=Glyma09g15895   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGTTAATGCAACCTTAGCTGCAATGGCAAGGCATGGAATGAACCAAAAGCCAGATATCAATGTGTACCAAATTGCTTCATCTGTAGTGAACCCTCTAGTCTTCCAAGACCTGGCAAGGCTTCTATATGAACACTACAGTTCCTCACCATGCATTGACTCAATGGGTAGGCCAATTCAAGTTCCACTGATGAAGTTTTTTAGCTCCACAGAAGAATTCTCTGGTCACCTGTGGAGAGATGCTATTCAGAAAAGAGGCATCACAGCTATGGCCTCCTCAAAGGCGAAGATGTCTCAGAAACTTGAAAACATGTGCAGAAAATCAGTGGAGCAAGCAAAGTACTTGGCCAACATTTATGAACCATACACATTTTATGGTGGAAGGTTTGATAACAGTAACACACAAAGATTGATGGAAAGCATGTCTGAAGAAGAAAAGAGGGAGTTTGACTTTGATGTAAAGAGCATCGATTGGAATGACTACATCACCAATGTCCATATACCTGGACTAAGGAGACATGTCATGAAGGGGAGAGGAATGGGGAGTCAGTGA
Predicted protein sequences of Glyma09g15895
>Glyma09g15895.1   sequence type=predicted peptide   gene model=Glyma09g15895   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVVNATLAAMARHGMNQKPDINVYQIASSVVNPLVFQDLARLLYEHYSSSPCIDSMGRPIQVPLMKFFSSTEEFSGHLWRDAIQKRGITAMASSKAKMSQKLENMCRKSVEQAKYLANIYEPYTFYGGRFDNSNTQRLMESMSEEEKREFDFDVKSIDWNDYITNVHIPGLRRHVMKGRGMGSQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo