SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g15575): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g15575): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g15575

Feature Type:gene_model
Chromosome:Gm09
Start:18302904
stop:18305474
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G57590AT Annotation by Michelle Graham. TAIR10: adenosylmethionine-8-amino-7-oxononanoate transaminases | chr5:23318593-23322687 REVERSE LENGTH=833 SoyBaseE_val: 2.00E-58ISS
GO:0006260GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication SoyBaseN/AISS
GO:0006270GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication initiation SoyBaseN/AISS
GO:0006275GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0009102GO-bp Annotation by Michelle Graham. GO Biological Process: biotin biosynthetic process SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0004015GO-mf Annotation by Michelle Graham. GO Molecular Function: adenosylmethionine-8-amino-7-oxononanoate transaminase activity SoyBaseN/AISS
GO:0004141GO-mf Annotation by Michelle Graham. GO Molecular Function: dethiobiotin synthase activity SoyBaseN/AISS
PTHR11986Panther AMINOTRANSFERASE CLASS III JGI ISS
PTHR11986:SF4Panther gb def: mxcl [stigmatella aurantiaca] JGI ISS
UniRef100_G7JD16UniRef Annotation by Michelle Graham. Most informative UniRef hit: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase-like protein n=1 Tax=Medicago truncatula RepID=G7JD16_MEDTR SoyBaseE_val: 5.00E-71ISS
UniRef100_UPI000233BAEEUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BAEE related cluster n=1 Tax=unknown RepID=UPI000233BAEE SoyBaseE_val: 9.00E-79ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g15575 not represented in the dataset

Glyma09g15575 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma09g15575.1   sequence type=CDS   gene model=Glyma09g15575   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACCAGTTATACAAGGTGCTGGTGGAATGCATATGGTTGATCCAGCTTTTCAGCGTGTGCTTGTTAAAGAGTGTCGAAGTAGAAAAATTCCAACTACGGTGGAGCTAATCCATTGTGTACCAGATATAGCTTGCTTTGGGAAGCTGATGACTGGTGAAATTATACCATTGGCTGTCACCTTGGCAACAAATGCTATTTTTGATTCATTTATTGGAGACTCAAAGTTATGGGATGATAAAATGGTTCACCGGATTTCATCATACCTTGCAATTCAAAGAGTAGTTGCTTTGGGAACTTTGTGTGCCTTGGAATTAAAAGCAGAAGGCAATAATGTCGAAGAAGCTAAGCTTAGGGAAGATGGTGTATACATGAGGCCTCTGGGTAATGTCATTTATCTGTTGTGTGGACCCAGCACATTTGCAGAAGTTTGCAATCAATTTACTCGCAAACTTCTTAGGCGGCTTGAAGAATTTGACGTATGTAAGAATTGA

>Glyma09g15575.1   sequence type=predicted peptide   gene model=Glyma09g15575   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEPVIQGAGGMHMVDPAFQRVLVKECRSRKIPTTVELIHCVPDIACFGKLMTGEIIPLAVTLATNAIFDSFIGDSKLWDDKMVHRISSYLAIQRVVALGTLCALELKAEGNNVEEAKLREDGVYMRPLGNVIYLLCGPSTFAEVCNQFTRKLLRRLEEFDVCKN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo