Glyma09g15470 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma09g15470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma09g15470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma09g15470

Feature Type:	gene_model
Chromosome:	Gm09
Start:	18069761
stop:	18087275
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g15470

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G42380	AT	Annotation by Michelle Graham. TAIR10: calmodulin like 37 \| chr5:16942758-16943315 REVERSE LENGTH=185	SoyBase	E_val: 1.00E-17	ISS
GO:0009693	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process	SoyBase	N/A	ISS
GO:0010193	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ozone	SoyBase	N/A	ISS
GO:0010286	GO-bp	Annotation by Michelle Graham. GO Biological Process: heat acclimation	SoyBase	N/A	ISS
GO:0030968	GO-bp	Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response	SoyBase	N/A	ISS
GO:0052542	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response by callose deposition	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005509	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calcium ion binding	SoyBase	N/A	ISS
PTHR10891	Panther	CALMODULIN	JGI		ISS
PTHR10891:SF141	Panther	CALCIUM-BINDING PROTEIN	JGI		ISS
UniRef100_G7J5J1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin-like protein n=2 Tax=Medicago truncatula RepID=G7J5J1_MEDTR	SoyBase	E_val: 4.00E-39	ISS
UniRef100_I1L2G2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L2G2_SOYBN	SoyBase	E_val: 8.00E-53	ISS

Expression Patterns of Glyma09g15470

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma09g15470 not represented in the dataset	Glyma09g15470 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g15470 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g102500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g15470

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g15470

Limit To All Plant Sequences

>Glyma09g15470.1   sequence type=CDS   gene model=Glyma09g15470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGGGTGGTGAGCTTCCAATGAAGGAAGCCGAGATGGCAATTGCGGCATTGGATTCTGATGGAGATGGGTTGCTGAGTTTGGAGGATTTCATTGCTCTCATGGAAGCTGGGGGAAAGGAGCAGAAGTTGAATGACTTGAAGGTAGCTTTTGACATGTATGACACTGAAAGCTGTGGGTTTATAACCCCTAAGAGCTTGAAAAAGATGCTTAAGAAGATGGGTGAGTCCAAATCCATTGATGAGTGCAAATCTATGATCAAATAG

Predicted protein sequences of Glyma09g15470

Limit To All Plant Sequences

>Glyma09g15470.1   sequence type=predicted peptide   gene model=Glyma09g15470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMGGELPMKEAEMAIAALDSDGDGLLSLEDFIALMEAGGKEQKLNDLKVAFDMYDTESCGFITPKSLKKMLKKMGESKSIDECKSMIK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain