|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G79530 | AT | Annotation by Michelle Graham. TAIR10: glyceraldehyde-3-phosphate dehydrogenase of plastid 1 | chr1:29916232-29919088 REVERSE LENGTH=422 | SoyBase | E_val: 5.00E-24 | ISS |
| GO:0005975 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process | SoyBase | N/A | ISS |
| GO:0006006 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucose metabolic process | SoyBase | N/A | ISS |
| GO:0006096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycolysis | SoyBase | N/A | ISS |
| GO:0009555 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pollen development | SoyBase | N/A | ISS |
| GO:0048658 | GO-bp | Annotation by Michelle Graham. GO Biological Process: tapetal layer development | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0080022 | GO-bp | Annotation by Michelle Graham. GO Biological Process: primary root development | SoyBase | N/A | ISS |
| GO:0080144 | GO-bp | Annotation by Michelle Graham. GO Biological Process: amino acid homeostasis | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009536 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0004365 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity | SoyBase | N/A | ISS |
| GO:0005507 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: copper ion binding | SoyBase | N/A | ISS |
| GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
| GO:0016620 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor | SoyBase | N/A | ISS |
| GO:0050661 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADP binding | SoyBase | N/A | ISS |
| GO:0051287 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NAD binding | SoyBase | N/A | ISS |
| PTHR10836 | Panther | GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE | JGI | ISS | |
| PF02800 | PFAM | Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain | JGI | ISS | |
| UniRef100_G7IQT0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Glyceraldehyde-3-phosphate dehydrogenase n=1 Tax=Medicago truncatula RepID=G7IQT0_MEDTR | SoyBase | E_val: 7.00E-24 | ISS |
| UniRef100_I1JMB4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JMB4_SOYBN | SoyBase | E_val: 8.00E-28 | ISS |
|
Glyma09g15175 not represented in the dataset |
Glyma09g15175 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g099700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g15175.1 sequence type=CDS gene model=Glyma09g15175 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCATTCCGTGTACCGACTCCTAATGTTTTTGTGGTGGACTTCACTTGCCGACTTAAGAAGAATGCTTCCTATGAAGATGTTAAAGCAGCAATAAAGTCAAGTATCTTTAATGCCATGGTTGGAATTGCACTAAGTGCTTCCTTTGTTAAGCTAGTTTCGTGCAACCGAGTATTGGACCTTATAGAGCACATGGCATTGGTTGGAGCTCAAAATGGAACACCATTAGTGTATGTTATGTTGCAATTGTTGTTGAATAGCGTTTAA
>Glyma09g15175.1 sequence type=predicted peptide gene model=Glyma09g15175 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAFRVPTPNVFVVDFTCRLKKNASYEDVKAAIKSSIFNAMVGIALSASFVKLVSCNRVLDLIEHMALVGAQNGTPLVYVMLQLLLNSV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||