|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G63160 | AT | Annotation by Michelle Graham. TAIR10: BTB and TAZ domain protein 1 | chr5:25333485-25335399 REVERSE LENGTH=365 | SoyBase | E_val: 1.00E-23 | ISS |
GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
GO:0009553 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo sac development | SoyBase | N/A | ISS |
GO:0009555 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pollen development | SoyBase | N/A | ISS |
GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
GO:0009751 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus | SoyBase | N/A | ISS |
GO:0042542 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0003712 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transcription cofactor activity | SoyBase | N/A | ISS |
GO:0004402 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: histone acetyltransferase activity | SoyBase | N/A | ISS |
GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
GO:0005516 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: calmodulin binding | SoyBase | N/A | ISS |
GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
PF02135 | PFAM | TAZ zinc finger | JGI | ISS | |
UniRef100_C6TKB6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TKB6_SOYBN | SoyBase | E_val: 1.00E-51 | ISS |
UniRef100_G7JMM9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Speckle-type POZ protein n=1 Tax=Medicago truncatula RepID=G7JMM9_MEDTR | SoyBase | E_val: 4.00E-32 | ISS |
Glyma09g14560 not represented in the dataset |
Glyma09g14560 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.09g098400 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g14560.1 sequence type=CDS gene model=Glyma09g14560 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAGTGTTTGGAGCACATATGCTATGATGGGTGTACCCACGTTGAACCGTACGATGCTGCGGAGGTGAAGAGGGAGAGGACTCCGTGTGGAAGAATCGCCACGTGCCAGGCTCTTCAGGTTCTGATCCGCCACTTTGCCACGTGCGAGAAGAAGGTGCGCGGCGGCTGCGTGCGGTGCAAGCGAATGTTGCAGCTCTTTCGACTCCATTCCTATCTTTGTCACCACACCGATTCATCCTGCAAGGTTCCTTTTTTGCCGGGCCTTTTGAGATTACTTCTTCTGCATGGAACAATTAGTTGA
>Glyma09g14560.1 sequence type=predicted peptide gene model=Glyma09g14560 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MECLEHICYDGCTHVEPYDAAEVKRERTPCGRIATCQALQVLIRHFATCEKKVRGGCVRCKRMLQLFRLHSYLCHHTDSSCKVPFLPGLLRLLLLHGTIS*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||