|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G47990 | AT | Annotation by Michelle Graham. TAIR10: SUGAR-INSENSITIVE 3 | chr3:17713367-17716051 REVERSE LENGTH=358 | SoyBase | E_val: 6.00E-12 | ISS |
| GO:0009644 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to high light intensity | SoyBase | N/A | ISS |
| GO:0010182 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010413 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process | SoyBase | N/A | ISS |
| GO:0016567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein ubiquitination | SoyBase | N/A | ISS |
| GO:0042542 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide | SoyBase | N/A | ISS |
| GO:0045492 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process | SoyBase | N/A | ISS |
| GO:0004842 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity | SoyBase | N/A | ISS |
| GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
| UniRef100_G7JPT9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: RING finger protein n=1 Tax=Medicago truncatula RepID=G7JPT9_MEDTR | SoyBase | E_val: 4.00E-20 | ISS |
| UniRef100_I1MTI1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTI1_SOYBN | SoyBase | E_val: 3.00E-23 | ISS |
|
Glyma09g14470 not represented in the dataset |
Glyma09g14470 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma09g14470.1 sequence type=CDS gene model=Glyma09g14470 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCCCCCTCCCCCTTTGTATGCTTCTAGAGATTTTGGGTGGCAGCAGAGATATCCTCGTTTCTGTGGAAGAGTAGTTGTCTTTTCAATCCTTGTGTTGCTTCTCTATCCATTTCTTTGGGCTTGGACTGTAATTGGTACCCTGTGGTTCAGCAGTGCCAAGAACTGTGTATGTTTTATTCTTGTTTTACCTTCAGTGTACTATTGTTAA
>Glyma09g14470.1 sequence type=predicted peptide gene model=Glyma09g14470 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MPPPPLYASRDFGWQQRYPRFCGRVVVFSILVLLLYPFLWAWTVIGTLWFSSAKNCVCFILVLPSVYYC*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||